Hyaluronan synthase 2 (Has2) Recombinant Protein | Has2 recombinant protein

Recombinant Mouse Hyaluronan synthase 2 (Has2)

Cat. Num. AAA113348

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Hyaluronan synthase 2 (Has2); N/A; Recombinant Mouse Hyaluronan synthase 2 (Has2); Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2; Has2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 67-374aa; Cytoplasmic Domain
• Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
• Sequence Length: 374

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Has2 recombinant protein

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.

References

Molecular cloning and characterization of a putative mouse hyaluronan synthase.Spicer A.P., Augustine M.L., McDonald J.A.J. Biol. Chem. 271:23400-23406(1996) Spicer A.P., Augustine M.L., McDonald J.A.Coding sequence of a hyaluronan synthase homologue expressed during expansion of the mouse cumulus-oocyte complex.Fueloep C., Salustri A., Hascall V.C.Arch. Biochem. Biophys. 337:261-266(1997) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Homologs of the Xenopus developmental gene DG42 are present in zebrafish and mouse and are involved in the synthesis of Nod-like chitin oligosaccharides during early embryogenesis.Semino C.E., Specht C.A., Raimondi A., Robbins P.W.Proc. Natl. Acad. Sci. U.S.A. 93:4548-4553(1996) Three isoforms of mammalian hyaluronan synthases have distinct enzymatic properties.Itano N., Sawai T., Yoshida M., Lenas P., Yamada Y., Imagawa M., Shinomura T., Hamaguchi M., Yoshida Y., Ohnuki Y., Miyauchi S., Spicer A.P., McDonald J.A., Kimata K.J. Biol. Chem. 274:25085-25092(1999) Disruption of hyaluronan synthase-2 abrogates normal cardiac morphogenesis and hyaluronan-mediated transformation of epithelium to mesenchyme.Camenisch T.D., Spicer A.P., Brehm-Gibson T., Biesterfeldt J., Augustine M.L., Calabro A. Jr., Kubalak S., Klewer S.E., McDonald J.A.J. Clin. Invest. 106:349-360(2000)

NCBI and Uniprot Product Information

• NCBI GeneID: 15117
• UniProt Accession #: P70312; P70411; Q62405; Q68EF7
• Molecular Weight: 37.9 kDa
• NCBI Official Synonym Full Names: hyaluronan synthase 2
• NCBI Official Symbol: Has2
• NCBI Protein Information: hyaluronan synthase 2
• UniProt Protein Name: Hyaluronan synthase 2
• UniProt Gene Name: Has2
• UniProt Synonym Gene Names: HA synthase 2
• UniProt Entry Name: HYAS2_MOUSE