Hyaluronan synthase 2 (Has2) Recombinant Protein | Has2 recombinant protein
Recombinant Mouse Hyaluronan synthase 2 (Has2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hyaluronan synthase 2 (Has2); N/A; Recombinant Mouse Hyaluronan synthase 2 (Has2); Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2; Has2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
67-374aa; Cytoplasmic Domain
Sequence
EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
Sequence Length
374
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Has2 recombinant protein
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.
References
Molecular cloning and characterization of a putative mouse hyaluronan synthase.Spicer A.P., Augustine M.L., McDonald J.A.J. Biol. Chem. 271:23400-23406(1996) Spicer A.P., Augustine M.L., McDonald J.A.Coding sequence of a hyaluronan synthase homologue expressed during expansion of the mouse cumulus-oocyte complex.Fueloep C., Salustri A., Hascall V.C.Arch. Biochem. Biophys. 337:261-266(1997) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Homologs of the Xenopus developmental gene DG42 are present in zebrafish and mouse and are involved in the synthesis of Nod-like chitin oligosaccharides during early embryogenesis.Semino C.E., Specht C.A., Raimondi A., Robbins P.W.Proc. Natl. Acad. Sci. U.S.A. 93:4548-4553(1996) Three isoforms of mammalian hyaluronan synthases have distinct enzymatic properties.Itano N., Sawai T., Yoshida M., Lenas P., Yamada Y., Imagawa M., Shinomura T., Hamaguchi M., Yoshida Y., Ohnuki Y., Miyauchi S., Spicer A.P., McDonald J.A., Kimata K.J. Biol. Chem. 274:25085-25092(1999) Disruption of hyaluronan synthase-2 abrogates normal cardiac morphogenesis and hyaluronan-mediated transformation of epithelium to mesenchyme.Camenisch T.D., Spicer A.P., Brehm-Gibson T., Biesterfeldt J., Augustine M.L., Calabro A. Jr., Kubalak S., Klewer S.E., McDonald J.A.J. Clin. Invest. 106:349-360(2000)
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
37.9 kDa
NCBI Official Synonym Full Names
hyaluronan synthase 2
NCBI Official Symbol
Has2
NCBI Protein Information
hyaluronan synthase 2
UniProt Protein Name
Hyaluronan synthase 2
UniProt Gene Name
Has2
UniProt Synonym Gene Names
HA synthase 2
UniProt Entry Name
HYAS2_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Has2 has2 (Catalog #AAA113348) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 67-374aa; Cytoplasmic Domain. The amino acid sequence is listed below: EHRKMKKSLE TPIKLNKTVA LCIAAYQEDP DYLRKCLQSV KRLTYPGIKV VMVIDGNSDD DLYMMDIFSE VMGRDKSATY IWKNNFHEKG PGETEESHKE SSQHVTQLVL SNKSICIMQK WGGKREVMYT AFRALGRSVD YVQVCDSDTM LDPASSVEMV KVLEEDPMVG GVGGDVQILN KYDSWISFLS SVRYWMAFNI ERACQSYFGC VQCISGPLGM YRNSLLHEFV EDWYNQEFMG NQCSFGDDRH LTNRVLSLGY ATKYTARSKC LTETPIEYLR WLNQQTRWSK SYFREWLYNA MWFHKHHL. It is sometimes possible for the material contained within the vial of "Hyaluronan synthase 2 (Has2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
