Hemoglobin subunit alpha Recombinant Protein | Hba recombinant protein
Recombinant Mouse Hemoglobin subunit alpha
Gene Names
Hba-a1; Hba; Hba1; Hbat1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemoglobin subunit alpha; N/A; Recombinant Mouse Hemoglobin subunit alpha; Alpha-globin; Hemoglobin alpha chain; Hba recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-142aa; Full Length of Mature Protein
Sequence
VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Hba recombinant protein
Involved in oxygen transport from the lung to the various peripheral tissues.
References
The complete sequence of a chromosomal mouse alpha-globin gene reveals elements conserved throughout vertebrate evolution.Nishioka Y., Leder P.Cell 18:875-882(1979) Hemoglobins of mice sequence and possible ambiguity at one position of the alpha chain.Popp R.A.J. Mol. Biol. 27:9-16(1967) Lubec G., Klug S., Kang S.U.Submitted (APR-2007) to UniProtKB Comparison of cloned mouse alpha- and beta-globin genes conservation of intervening sequence locations and extragenic homology.Leder A., Miller H.I., Hamer D.H., Seidman J.G., Norman B., Sullivan M., Leder P.Proc. Natl. Acad. Sci. U.S.A. 75:6187-6191(1978) Characterization and kinetics of synthesis of 15S beta-globin RNA, a putative precursor of beta-globin mRNA.Curtis P.J., Mantei N., Weissmann C.Cold Spring Harb. Symp. Quant. Biol. 42:971-984(1978) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Studies on the mouse hemoglobin loci. 8. A fourth alpha-chain phenotype.Popp R.A.J. Hered. 60:126-133(1969) Popp R.A.(In) Altman P.A., Katz D.D. (eds.) ;Inbred and genetically defined strains of laboratory animals, pp.105-105, Federation of American Societies for Experimental Biology, Bethesda (1979) The primary structure of genetic variants of mouse hemoglobin.Popp R.A., Bailiff E.G., Skow L.C., Whitney J.B. IIIBiochem. Genet. 20:199-208(1982)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
Hemoglobin subunit alpha
NCBI Official Synonym Full Names
hemoglobin alpha, adult chain 1
NCBI Official Symbol
Hba-a1
NCBI Official Synonym Symbols
Hba; Hba1; Hbat1
NCBI Protein Information
hemoglobin subunit alpha
UniProt Protein Name
Hemoglobin subunit alpha
UniProt Gene Name
Hba
UniProt Synonym Gene Names
Hba-a1
UniProt Entry Name
HBA_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Hba hba (Catalog #AAA116121) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-142aa; Full Length of Mature Protein. The amino acid sequence is listed below: VLSGEDKSNI KAAWGKIGGH GAEYGAEALE RMFASFPTTK TYFPHFDVSH GSAQVKGHGK KVADALASAA GHLDDLPGAL SALSDLHAHK LRVDPVNFKL LSHCLLVTLA SHHPADFTPA VHASLDKFLA SVSTVLTSKY R. It is sometimes possible for the material contained within the vial of "Hemoglobin subunit alpha, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
