Hemoglobin subunit beta-2 Recombinant Protein | Hbb-b2 recombinant protein
Recombinant Mouse Hemoglobin subunit beta-2
Gene Names
Hbb-b2; Hbb2; Hbbt2; beta2; AI036344
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemoglobin subunit beta-2; N/A; Recombinant Mouse Hemoglobin subunit beta-2; Beta-2-globin; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain; Hbb-b2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-147aa; Full Length
Sequence
VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Sequence Length
147
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Hbb-b2 recombinant protein
Involved in oxygen transport from the lung to the various peripheral tissues.
References
Nucleotide sequence of the BALB/c mouse beta-globin complex.Shehee W.R., Loeb D.D., Adey N.B., Burton F.H., Casavant N.C., Cole P., Davies C.J., McGraw R.A., Schichman S.A., Severynse D.M., Voliva C.F., Weyter F.W., Wisely G.B., Edgell M.H., Hutchison C.A. IIIJ. Mol. Biol. 205:41-62(1989) The evolution and sequence comparison of two recently diverged mouse chromosomal beta-globin genes.Konkel D.A., Maizel J.V. Jr., Leder P.Cell 18:865-873(1979) Mouse haemoglobin beta chains. Comparative sequence data on adult major and minor beta chains from two species, Mus musculus and Mus cervicolor.Gilman J.G.Biochem. J. 159:43-53(1976) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17.7 kDa
NCBI Official Full Name
hemoglobin subunit beta-2
NCBI Official Synonym Full Names
hemoglobin, beta adult minor chain
NCBI Official Symbol
Hbb-b2
NCBI Official Synonym Symbols
Hbb2; Hbbt2; beta2; AI036344
NCBI Protein Information
hemoglobin subunit beta-2
UniProt Protein Name
Hemoglobin subunit beta-2
UniProt Gene Name
Hbb-b2
UniProt Entry Name
HBB2_MOUSE
Similar Products
Product Notes
The Hbb-b2 hbb-b2 (Catalog #AAA116000) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-147aa; Full Length. The amino acid sequence is listed below: VHLTDAEKSA VSCLWAKVNP DEVGGEALGR LLVVYPWTQR YFDSFGDLSS ASAIMGNPKV KAHGKKVITA FNEGLKNLDN LKGTFASLSE LHCDKLHVDP ENFRLLGNAI VIVLGHHLGK DFTPAAQAAF QKVVAGVATA LAHKYH. It is sometimes possible for the material contained within the vial of "Hemoglobin subunit beta-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
