HBsAg ayw Recombinant Protein | HBsAg recombinant protein
HBsAg ayw, Hepatitis B Surface Antigen Ayw subtype, Saccharomyces
Applications
Western Blot, ELISA
Purity
> 95% pure by SDS-PAGE
Synonyms
HBsAg ayw; N/A; HBsAg ayw, Hepatitis B Surface Antigen Ayw subtype, Saccharomyces; HBsAg ayw recombinant protein; HBsAg ayw Recombinant Protein; HBsAg recombinant protein
Host
Saccharomyces cerevisae.
Purity/Purification
> 95% pure by SDS-PAGE
Concentration
50 ug/50 ul in 50 mM phosphate buffer pH7.2, 200 mM NaCI (varies by lot)
Sequence
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQS PTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLI PGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFF CLWVYI (Genebank accession#, CAA05872).
Applicable Applications for HBsAg recombinant protein
WB (Western Blot), ELISA, Immunogen
Preparation and Storage
Store at 4°C for immediate use. Stable for 6 months from the date of receipt at -20°C. Non-hazardous.
Related Product Information for HBsAg recombinant protein
HBsAg is the surface antigen of the Hepatitis-B-Virus and commonly referred to as the Australian Antigen.
The recombinant HBsAg ayw full length monomeric protein contains a 226 amino acids of the S-gene with a molecular weight of 25kDa. Small amounts of dimmer and trimer forms also exist in the solution.
The recombinant HBsAg ayw full length monomeric protein contains a 226 amino acids of the S-gene with a molecular weight of 25kDa. Small amounts of dimmer and trimer forms also exist in the solution.
Product Categories/Family for HBsAg recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HBsAg (Catalog #AAA13759) is a Recombinant Protein produced from Saccharomyces cerevisae. and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HBsAg ayw can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, Immunogen. Researchers should empirically determine the suitability of the HBsAg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MENITSGFLG PLLVLQAGFF LLTRILTIPQ SLDSWWTSLN FLGGTTVCLG QNSQS PTSNHSPTSC PPTCPGYRWM CLRRFIIFLF ILLLCLIFLL VLLDYQGMLP VCPLI PGSSTTSTGP CRTCMTTAQG TSMYPSCCCT KPSDGNCTCI PIPSSWAFGK FLWEW ASARFSWLSL LVPFVQWFVG LSPTVWLSVI WMMWYWGPSL YSILSPFLPL LPIFF CLWVYI (Genebank accession#, CAA05872). It is sometimes possible for the material contained within the vial of "HBsAg ayw, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
