Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Hepatitis B Surface Antigen preS2 Recombinant Protein | HBsAg recombinant protein

Recombinant Hepatitis B Surface Antigen preS2

Average rating 0.0
No ratings yet
Purity
Greater than 95% as determined by:
A) Analysis by RP-HPLC
B) Analysis by SDS-PAGE.
Synonyms
Hepatitis B Surface Antigen preS2; N/A; Recombinant Hepatitis B Surface Antigen preS2; HBsAg preS2; Hepatitis B Surface Antigen, preS2 Recombinant; HBsAg recombinant protein
Ordering
Host
E.coli
Purity/Purification
Greater than 95% as determined by:
A) Analysis by RP-HPLC
B) Analysis by SDS-PAGE.
Form/Format
Lyophilized from 0.2 um filtered (1mg/ml) solution in 20mM PB, pH7.4 and 50mM NaCl.
Sequence
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN
Sequence Length
57
Solubility
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Preparation and Storage
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Related Product Information for HBsAg recombinant protein
The Recombinant Hepatitis B Surface Antigen preS2 is a approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.
Product Categories/Family for HBsAg recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
HBsAg, partial
UniProt Protein Name
HBsAg
UniProt Gene Name
HBsAg
UniProt Entry Name
Q09LT5_HBV

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HBsAg hbsag (Catalog #AAA38298) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MQWNSTTFHQ ALLDPKVRGL YFPAGGSSSG TVNPVPTTAS P ISSIFSRTGD PAPN. It is sometimes possible for the material contained within the vial of "Hepatitis B Surface Antigen preS2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.