Growth Differentiation Factor 15 (hGDF15) Active Protein | hGDF15 active protein
Recombinant Human Growth Differentiation Factor 15 (hGDF15)
Purity
>95%, determined by SDS-PAGE
Synonyms
Growth Differentiation Factor 15 (hGDF15); N/A; Recombinant Human Growth Differentiation Factor 15 (hGDF15); Growth Differentiation Factor 15; hGDF15 active protein
Host
HEK293 cells
Purity/Purification
>95%, determined by SDS-PAGE
Form/Format
Lyophilized at 0.1mg/mL in NaCl 137mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH8.0.
Sequence
HHHHHHGGGGSARNGDHCPLGPGRCCRLH TVRASLEDLGWADWVLSPREVQVTMCIGACP SQFRAANMHAQIKTSLHRLKPDTVPAPCCVPA SYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Species
Human
Endotoxin Level
<0.2EU/ug, determined by LAL Test
Tag
N-terminal 6xHis
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1mg/mL and let the lyophilized pellet dissolve completely.
Bioactivity Test
Recombinant hGDF15 is able to activate AKT and ERK phosphorylation in HEK293 cells co-transfected with GFRAL and RET51, which are receptor and co-receptor of GDF15.
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot reconstituted protein and store at -80 degree C. Avoid repeated freezing /thawing cycles.
Related Product Information for hGDF15 active protein
GDF-15 belongs to the transforming growth factor beta superfamily. It is synthesized as a 62-kDa precursor protein, which, after cleavage by furin-like protease, is secreted as 25-kDa disulfide-linked dimmer. GDF15 is an important regulator of appetite and energy homeostasis. It exerts its effects via its receptor called glial-derived neurotrophic factor (GDNF) receptor alpha-like (GFRAL).
Similar Products
Product Notes
The hGDF15 (Catalog #AAA60567) is an Active Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HHHHHHGGGG SARNGDHCPL GPGRCCRLH TVRASLEDLG WADWVLSPRE VQVTMCIGAC P SQFRAANMHA QIKTSLHRLK PDTVPAPCCV PA SYNPMVLIQK TDTGVSLQTY DDLLAKDCHC I. It is sometimes possible for the material contained within the vial of "Growth Differentiation Factor 15 (hGDF15), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
