Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281509_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Frizzled-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-66 kDa.)

Frizzled-1 Active Protein | FZD1 active protein

Recombinant Human Frizzled-1 Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
Frizzled-1; N/A; Recombinant Human Frizzled-1 Protein; DKFZp564G072; FLJ95923; frizzled family receptor 1; frizzled homolog 1; frizzled; Drosophila; homolog of; 1; Frizzled1; fz-1; fzE1; hFz1; seven transmembrane spanning receptor; Wnt receptor; FZD1 active protein
Ordering
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH
Sequence Length
647
Species
Human
Endotoxin
Please contact us for more information.
Biological Activity
Measured by its binding ability in a functional ELISA. In a 100 uL reaction mixture containing biotinylated rmWnt-5a at 100 ng/mL and rhFrizzled-1 dilutions at 0.1-8, 000 ng/mL, the concentration of rhFrizzled-1 that produces 50% of the optimal binding response is found to be approximately 20-80 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-PAGE

(Recombinant Human Frizzled-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-66 kDa.)

product-image-AAA281509_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human Frizzled-1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-66 kDa.)
Related Product Information for FZD1 active protein
Description: Recombinant Human Frizzled-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln73-His253) of human Frizzled-1 (Accession #NP_003496.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: This protein belongs to the G-protein coupled receptor Fz/Smo family. FZD1 contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, 7 transmembrane domains, and a C-terminal PDZ domain-binding motif. FZD1 is expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney. Frizzled is a family of G protein-coupled receptor proteins that serve as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Dishevelled in the cytosol. Frizzled proteins and the genes encoding them have been identified in an array of animals, from sponges to humans. Frizzled proteins play key roles in governing cell polarity, embryonic development, formation of neural synapses, cell proliferation, and many other processes in developing and adult organisms. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes.
Product Categories/Family for FZD1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
frizzled-1
NCBI Official Synonym Full Names
frizzled class receptor 1
NCBI Official Symbol
FZD1
NCBI Protein Information
frizzled-1
UniProt Protein Name
Frizzled-1
UniProt Gene Name
FZD1
UniProt Synonym Gene Names
Fz-1; hFz1
UniProt Entry Name
FZD1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FZD1 fzd1 (Catalog #AAA281509) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QAAGQGPGQG PGPGQQPPPP PQQQQSGQQY NGERGISVPD HGYCQPISIP LCTDIAYNQT IMPNLLGHTN QEDAGLEVHQ FYPLVKVQCS AELKFFLCSM YAPVCTVLEQ ALPPCRSLCE RARQGCEALM NKFGFQWPDT LKCEKFPVHG AGELCVGQNT SDKGTPTPSL LPEFWTSNPQ H. It is sometimes possible for the material contained within the vial of "Frizzled-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.