Follicle Stimulating Hormone Active Protein | FSH active protein
Recombinant Human Follicle Stimulating Hormone
Purity
Greater than 95.0% as determined by SDS-PAGE.
Synonyms
Follicle Stimulating Hormone; N/A; Recombinant Human Follicle Stimulating Hormone; FSH Human; Follicle Stimulating Hormone Human Recombinant; Follitropin subunit beta; Follicle-stimulating hormone beta subunit; FSH-beta; FSH-B; Follitropin beta chain; FSH; FSH active protein
Host
HEK293
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE.
Form/Format
The recombinant FSH was lyophilized from 0.2um filtered solution containing PBS, pH 7.4.
Sequence
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS.
FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Sequence Length
129
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Preparation and Storage
Lyophilized FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for FSH active protein
FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Met1-Ser116) and human FSH-beta chain(Accession # P01225) (Met1-Glu129) having a total Mw of 38kDa. FSH human recombinant is purified by proprietary chromatographic techniques.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
follitropin subunit beta
NCBI Official Synonym Full Names
follicle stimulating hormone, beta polypeptide
NCBI Official Symbol
FSHB
NCBI Protein Information
follitropin subunit beta; FSH-B; FSH-beta; follicle-stimulating hormone beta subunit; follitropin beta chain; follitropin, beta chain
UniProt Protein Name
Follitropin subunit beta
UniProt Gene Name
FSHB
UniProt Synonym Gene Names
FSH-B; FSH-beta
UniProt Entry Name
FSHB_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The FSH fshb (Catalog #AAA38350) is an Active Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FSH subunit alpha: APDVQDCPEC TLQENPFFSQ PGAPILQCMG CCFSRAYPTP LRSKKTMLVQ KNVTSESTCC VAKSYNRVTV MGGFKVENHT ACHCSTCYYH KS. FSH subunit beta: NSCELTNITI AIEKEECRFC ISINTTWCAG YCYTRDLVYK DPARPKIQKT CTFKELVYET VRVPGCAHHA DSLYTYPVAT QCHCGKCDSD STDCTVRGLG PSYCSFGEMK E. It is sometimes possible for the material contained within the vial of "Follicle Stimulating Hormone, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.