Helicobacter Pylori Outer Membrane Protein Recombinant Protein
Recombinant Helicobacter Pylori Outer Membrane Protein
Purity
Purity: Greater than 95% pure as determined by 12% PAGE (Coomassie staining).Purification Method: Purified by proprietary chromatographic technique.
Synonyms
Helicobacter Pylori Outer Membrane Protein; N/A; Recombinant Helicobacter Pylori Outer Membrane Protein; Omp Pylori; Helicobacter Pylori Outer Membrane Protein Recombinant; Helicobacter Pylori Outer Membrane Protein recombinant protein
Purity/Purification
Purity: Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Purification Method: Purified by proprietary chromatographic technique.
Purification Method: Purified by proprietary chromatographic technique.
Form/Format
(1.55mg/mL) Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Sterile filtered liquid formulation.
Sterile filtered liquid formulation.
Concentration
1.55 mg/ml (varies by lot)
Sequence
MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL
Source
E.Coli
Preparation and Storage
Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Related Product Information for Helicobacter Pylori Outer Membrane Protein recombinant protein
Description: Omp Pylori recombinant antigen is produced in E Coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Product Categories/Family for Helicobacter Pylori Outer Membrane Protein recombinant protein
Similar Products
Product Notes
The Helicobacter Pylori Outer Membrane Protein (Catalog #AAA38852) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLVTKLAPDF KAPAVLGNNE VDEHFELSKN LGKNGAILFF WPKDFTFVCP TEIIAFDKRV KDFQEK GFNVIGVSID SEQVHFAWKN TPVEKGGIGQ VTFPMVADIT KSISRDYDVL FEEAIALRGA FLIDKNMKVR HAVINDLPLG RNADEMLRMV DALLHFEEHG EVCPAGWRKG DKGMKATHQG VAEYLKENSI KL. It is sometimes possible for the material contained within the vial of "Helicobacter Pylori Outer Membrane Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.