Hepatitis C Virus NS4 a+b Recombinant Protein | HCV recombinant protein
Recombinant Hepatitis C Virus NS4 a+b
Applications
Western Blot, ELISA
Purity
Purity: Protein is >95% pure as determined by 10% PAGE (coomassie staining)Purification: Purified by proprietary chromatographic technique.
Synonyms
Hepatitis C Virus NS4 a+b; N/A; Recombinant Hepatitis C Virus NS4 a+b; HCV NS4 a+b; Hepatitis C Virus NS4 a+b Recombinant; HCV recombinant protein
Specificity
Immunoreactive with sera of HCV-infected individuals.
Purity/Purification
Purity: Protein is >95% pure as determined by 10% PAGE (coomassie staining)
Purification: Purified by proprietary chromatographic technique.
Purification: Purified by proprietary chromatographic technique.
Form/Format
20mM Tris-Hcl pH 8, 8M urea.
Concentration
1mg/ml (varies by lot)
Sequence
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Applicable Applications for HCV recombinant protein
WB (Western Blot), ELISA
Preparation and Storage
HCV NS4 a+b although stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for HCV recombinant protein
Description: The E Coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.
Introduction: HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).
Introduction: HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).
Product Categories/Family for HCV recombinant protein
Similar Products
Product Notes
The HCV (Catalog #AAA38319) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Hepatitis C Virus NS4 a+b can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the HCV for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: 1658 TWVLVGGVLA ALAAYCLSTG CVVIVGRVVL SGKPAIIPDR EVLYREFDEM EECSQHLPYI EQGMMLAEQF KQKALGLLQT ASRQAEVIAP AVQTNWQKLE TFWAKHMWNF ISGIQYLAGL STLPGNPAIA SLMAFTAAVT SPLTTSQTLL FNILGGWVAA QLAAPGAATA FVGAGLAGAA IGSVGLGKVL IDILAGYGAG VAGAL 1863. It is sometimes possible for the material contained within the vial of "Hepatitis C Virus NS4 a+b, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.