Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Hedgehog-interacting protein (Hhip) Recombinant Protein | Hhip recombinant protein

Recombinant Mouse Hedgehog-interacting protein (Hhip)

Average rating 0.0
No ratings yet
Gene Names
Hhip; Hhip1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hedgehog-interacting protein (Hhip); N/A; Recombinant Mouse Hedgehog-interacting protein (Hhip); Hhip recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-700, Full length protein
Sequence
FFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRVMSQLELLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQSLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCFPDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSHRLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGASSSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRVTVQPAQPLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV
Sequence Length
683
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Hhip recombinant protein
This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,513 Da
NCBI Official Full Name
hedgehog-interacting protein
NCBI Official Synonym Full Names
Hedgehog-interacting protein
NCBI Official Symbol
Hhip
NCBI Official Synonym Symbols
Hhip1
NCBI Protein Information
hedgehog-interacting protein
UniProt Protein Name
Hedgehog-interacting protein
UniProt Gene Name
Hhip
UniProt Synonym Gene Names
Hip; HHIP; HIP

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Hhip hhip (Catalog #AAA117075) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-700, Full length protein. The amino acid sequence is listed below: FFEGDAKFGE RNEGSGARRR RCLNGNPPKR LKRRDRRVMS QLELLSGGEI LCGGFYPRVS CCLQSDSPGL GRLENKIFSA TNNSECSRLL EEIQCAPCSP HSQSLFYTPE RDVLDGDLAL PLLCKDYCKE FFYTCRGHIP GLLQTTADEF CFYYARKDAG LCFPDFPRKQ VRGPASNYLG QMEDYEKVGG ISRKHKHNCL CVQEVMSGLR QPVSAVHSGD GSHRLFILEK EGYVKILTPE GELFKEPYLD IHKLVQSGIK GGDERGLLSL AFHPNYKKNG KLYVSYTTNQ ERWAIGPHDH ILRVVEYTVS RKNPHQVDVR TARVFLEVAE LHRKHLGGQL LFGPDGFLYI ILGDGMITLD DMEEMDGLSD FTGSVLRLDV DTDMCNVPYS IPRSNPHFNS TNQPPEVFAH GLHDPGRCAV DRHPTDININ LTILCSDSNG KNRSSARILQ IIKGRDYESE PSLLEFKPFS NGPLVGGFVY RGCQSERLYG SYVFGDRNGN FLTLQQSPVT KQWQEKPLCL GASSSCRGYF SGHILGFGED ELGEVYILSS SKSMTQTHNG KLYKIVDPKR PLMPEECRVT VQPAQPLTSD CSRLCRNGYY TPTGKCCCSP GWEGDFCRIA KCEPACRHGG VCVRPNKCLC KKGYLGPQCE QVDRNVRRVT RAGILDQIID MTSYLLDLTS YIV. It is sometimes possible for the material contained within the vial of "Hedgehog-interacting protein (Hhip), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.