HIV-1 gp41 Long Recombinant Protein
Recombinant HIV-1 gp41 Long (466-753 a.a.)
Purity
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Synonyms
HIV-1 gp41 Long; N/A; Recombinant HIV-1 gp41 Long (466-753 a.a.); HIV-1 gp41 Long Recombinant; HIV-1 gp41 Long recombinant protein
Host
E Coli
Specificity
Immunoreactive with all sera of HIV-1 infected individuals.
Purity/Purification
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Form/Format
10mM Na2CO3, 10mM Na3EDTA, 10mM Mb-mercaptoethanol, 0.05% tween-20.
Sterile filtered colorless clear solution.
Sterile filtered colorless clear solution.
Sequence
IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Preparation and Storage
HIV-1 gp41 Long although stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for HIV-1 gp41 Long recombinant protein
Description: The E Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 288 amino acids (466-753) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.
Introduction: Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
Introduction: Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells(specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.
Product Categories/Family for HIV-1 gp41 Long recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HIV-1 gp41 Long (Catalog #AAA38330) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: IEFPGIFRPG GGDMRDNWRS ELYKYKVVKI EPLGVAPTKA KRRVVQ REKRAVGIGA LFLGFLGAAG STMGAASMTL TVQARQLLSG IVQQQNNLLR AIEAQQHLLQ LTVWGIKQLQ ARILAVERYL KDQQLLGIWG CSGKLICTTA VPWNASWSN KSLEQIWNNM TWMEWDREIN NYTSLIHSLI EESQNQQEKN EQELLELDKW ASLWNWFNIT NWLWYIKLFI MIVGGLVGLR IVFAVLSVVN RVRQGYSPLS FQTHLPIPRG PDRPEGIEEE GGERDRDRSI RLVNGSLALI WDDLRSLCLF SYHRLRDLLL IVTRIVELLG RRGWEALKYW WNLLQYWSQE LKNSAVSLLN ATAIAVAEGT DRVIEVVQGA YRAIRHIPRR IRQGLERILL. It is sometimes possible for the material contained within the vial of "HIV-1 gp41 Long, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.