HIV-2 gp36 Recombinant Protein
Recombinant HIV-2 gp36 (390-702)
Applications
Western Blot, ELISA
Purity
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Synonyms
HIV-2 gp36; N/A; Recombinant HIV-2 gp36 (390-702); HIV-2 gp-36 (390-702 a.a.); HIV-2 gp36 (390-702 a.a.) Recombinant; HIV-2 gp36 (390-702); HIV-2 gp36 recombinant protein
Host
E Coli
Specificity
Reactive with human HIV positive serum.
Purity/Purification
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Form/Format
(1mg/1ml) 0.01M Na2CO3, 0.01M Na3EDTA, 0.014 M?-mercaptoethanol, 0.02% Sarcosyl.
Sterile filtered colorless clear solution.
Sterile filtered colorless clear solution.
Concentration
1mg/ml (varies by lot)
Sequence
EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Applicable Applications for HIV-2 gp36 recombinant protein
WB (Western Blot), ELISA
Preparation and Storage
Stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for HIV-2 gp36 recombinant protein
Description: HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.
Introduction: HIV-1 and HIV-2 appear to package their RNA differently. HIV-1 binds to any appropriate RNA whereas HIV-2 preferentially binds to mRNA which creates the Gag protein itself. This means that HIV-1 is better able to mutate. HIV-2 is transmitted in the same ways as HIV-1: Through exposure to bodily fluids such as blood, semen, tears and vaginal fluids. Immunodeficiency develops more slowly with HIV-2.HIV-2 is less infectious in the early stages of the virus than with HIV-1.The infectiousness of HIV-2 increases as the virus progresses.Major differences include reduced pathogenicity of HIV-2 relative to HIV-1, enhanced immune control of HIV-2 infection and often some degree of CD4-independence. Despite considerable sequence and phenotypic differences between HIV-1 and 2 envelopes, structurally they are quite similar. Both membrane-anchored proteins eventually form the 6-helix bundles from the N-terminal and C-terminal regions of the ectodomain, which is common to many viral and cellular fusion proteins and which seems to drive fusion. HIV-1 gp41 helical regions can form more stable 6-helix bundles than HIV-2 gp41 helical regions however HIV-2 fusion occurs at a lower threshold temperature (25 degree C), does not require Ca2+ in the medium, is insensitive to treatment of target cells with cytochalasin B, and is not affected by target membrane glycosphingolipid composition.
Introduction: HIV-1 and HIV-2 appear to package their RNA differently. HIV-1 binds to any appropriate RNA whereas HIV-2 preferentially binds to mRNA which creates the Gag protein itself. This means that HIV-1 is better able to mutate. HIV-2 is transmitted in the same ways as HIV-1: Through exposure to bodily fluids such as blood, semen, tears and vaginal fluids. Immunodeficiency develops more slowly with HIV-2.HIV-2 is less infectious in the early stages of the virus than with HIV-1.The infectiousness of HIV-2 increases as the virus progresses.Major differences include reduced pathogenicity of HIV-2 relative to HIV-1, enhanced immune control of HIV-2 infection and often some degree of CD4-independence. Despite considerable sequence and phenotypic differences between HIV-1 and 2 envelopes, structurally they are quite similar. Both membrane-anchored proteins eventually form the 6-helix bundles from the N-terminal and C-terminal regions of the ectodomain, which is common to many viral and cellular fusion proteins and which seems to drive fusion. HIV-1 gp41 helical regions can form more stable 6-helix bundles than HIV-2 gp41 helical regions however HIV-2 fusion occurs at a lower threshold temperature (25 degree C), does not require Ca2+ in the medium, is insensitive to treatment of target cells with cytochalasin B, and is not affected by target membrane glycosphingolipid composition.
Product Categories/Family for HIV-2 gp36 recombinant protein
Similar Products
Product Notes
The HIV-2 gp36 (Catalog #AAA38339) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HIV-2 gp36 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the HIV-2 gp36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EQTMVQDDPS TCRGEFLYCN MTWFLNWIEN KTHRNYAPCH IKQIINTWHK VGRNVYLPPR EGELSCNSTV TSIIANIDWQ NNNQTNITFS AEVAELYRLE LGDYKLVEIT PIGFAPTKEK RYSSAHGRHT RGVFVLGFLG FLATAGSAMG AASLTVSAQS RTLLAGIVQQ QQQLLDVVKR QQELLRLTVW GTKNLQARVT AIEKYLQDQA RLNSWGCAFR QVCHTTVPWV NDSLAPDWDN MTWQEWEKQV RYLEANISKS LEQAQIQQEK NMYELQKLNS WDIFGNWFDL TSWVKYIQYG VLIIVAVIAL RIVIYVVQML SRLRKGYRPV FSSPPGYIQQ IHIHKDRGQP ANEETEEDGG SNGGDRYWPW PIAYIHFLIR QLIRLLTRLY SICSQAC. It is sometimes possible for the material contained within the vial of "HIV-2 gp36, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.