Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA81617_SDS_PAGE15.jpg SDS-PAGE

Heterogeneous nuclear ribonucleoprotein H Recombinant Protein | HNRPH1 recombinant protein

Recombinant Human Heterogeneous nuclear ribonucleoprotein H

Average rating 0.0
No ratings yet
Gene Names
HNRNPH1; HNRPH; HNRPH1; hnRNPH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein H; N/A; Recombinant Human Heterogeneous nuclear ribonucleoprotein H; HNRPH1 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
Region: 2-216aa; partial
Sequence
MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA81617_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for HNRPH1 recombinant protein
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Product Categories/Family for HNRPH1 recombinant protein
References
Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.Honore B., Rasmussen H.H., Vorum H., Dejgaard K., Liu X., Gromov P., Madsen P., Gesser B., Tommerup N., Celis J.E.J. Biol. Chem. 270:28780-28789(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51.2 kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein H
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein H1 (H)
NCBI Official Symbol
HNRNPH1
NCBI Official Synonym Symbols
HNRPH; HNRPH1; hnRNPH
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein H
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein H
UniProt Gene Name
HNRNPH1
UniProt Synonym Gene Names
HNRPH; HNRPH1; hnRNP H
UniProt Entry Name
HNRH1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNRPH1 hnrnph1 (Catalog #AAA81617) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Region: 2-216aa; partial. The amino acid sequence is listed below: MLGTEGGEGF VVKVRGLPWS CSADEVQRFF SDCKIQNGAQ GIRFIYTREG RPSGEAFVEL ESEDEVKLAL KKDRETMGHR YVEVFKSNNV EMDWVLKHTG PNSPDTANDG FVRLRGLPFG CSKEEIVQFF SGLEIVPNGI TLPVDFQGRS TGEAFVQFAS QEIAEKALKK HKERIGHRYI EIFKSSRAEV RTHYDPPRKL MAMQRPGPYD RPGAG. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein H, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.