SDS-PAGE
Histamine H1 receptor (HRH1) Recombinant Protein | HRH1 recombinant protein
Recombinant Human Histamine H1 receptor (HRH1), partial
Gene Names
HRH1; H1-R; hisH1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histamine H1 receptor (HRH1); N/A; Recombinant Human Histamine H1 receptor (HRH1), partial; Recombinant Histamine H1 receptor (HRH1); Histamine H1 receptor; H1R; HH1R; HRH1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
211-416aa; Partial
Sequence
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for HRH1 recombinant protein
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Product Categories/Family for HRH1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.1 kDa
NCBI Official Full Name
histamine H1 receptor
NCBI Official Synonym Full Names
histamine receptor H1
NCBI Official Symbol
HRH1
NCBI Official Synonym Symbols
H1-R; hisH1
NCBI Protein Information
histamine H1 receptor; H1R; HH1R; histamine receptor, subclass H1
UniProt Protein Name
Histamine H1 receptor
UniProt Gene Name
HRH1
UniProt Synonym Gene Names
H1R; HH1R
UniProt Entry Name
HRH1_HUMAN
Similar Products
Product Notes
The HRH1 hrh1 (Catalog #AAA114029) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 211-416aa; Partial. The amino acid sequence is listed below: AKIYKAVRQH CQHRELINRS LPSFSEIKLR PENPKGDAKK PGKESPWEVL KRKPKDAGGG SVLKSPSQTP KEMKSPVVFS QEDDREVDKL YCFPLDIVHM QAAAEGSSRD YVAVNRSHGQ LKTDEQGLNT HGASEISEDQ MLGDSQSFSR TDSDTTTETA PGKGKLRSGS NTGLDYIKFT WKRLRSHSRQ YVSGLHMNRE RKAAKQ. It is sometimes possible for the material contained within the vial of "Histamine H1 receptor (HRH1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.