Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

BCAM blocking peptide

BCAM Peptide - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
BCAM; AU; LU; CD239; MSK19
Reactivity
Human
Applications
Western Blot
Synonyms
BCAM; N/A; BCAM Peptide - C-terminal region; BCAM blocking peptide
Ordering
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL
Sequence Length
628
Applicable Applications for BCAM blocking peptide
WB (Western Blot)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BCAM blocking peptide
This is a synthetic peptide designed for use in combination with anti-BCAM Antibody, made

Target Description: Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for BCAM blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
basal cell adhesion molecule isoform 1
NCBI Official Synonym Full Names
basal cell adhesion molecule (Lutheran blood group)
NCBI Official Symbol
BCAM
NCBI Official Synonym Symbols
AU; LU; CD239; MSK19
NCBI Protein Information
basal cell adhesion molecule
UniProt Protein Name
Basal cell adhesion molecule
UniProt Gene Name
BCAM
UniProt Synonym Gene Names
LU; MSK19

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCAM bcam (Catalog #AAA201842) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BCAM Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCAM can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BCAM bcam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SALSRDGISC EASNPHGNKR HVFHFGTVSP QTSQAGVAVM AVAVSVGLLL. It is sometimes possible for the material contained within the vial of "BCAM, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.