NEK9 blocking peptide
NEK9 Peptide - C-terminal region
Gene Names
NEK9; NC; APUG; NERCC; LCCS10; NERCC1
Reactivity
Human
Applications
Western Blot
Synonyms
NEK9; N/A; NEK9 Peptide - C-terminal region; NEK9 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Applicable Applications for NEK9 blocking peptide
WB (Western Blot)
Gene symbol
NEK9
Alias symbols
NEK9,KIAA1995,NEK8,NERCC,
Peptide sequence
Synthetic peptide located within the following region: DSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLR
Quality control
The peptide is characterized by mass spectroscopy
Protein size
979 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Related Product Information for NEK9 blocking peptide
Description: This is a synthetic peptide designed for use in combination with anti-NEK9 Antibody (MBS3219529). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Description of target: NEK9 is a pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. It phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. It is important for G1/S transition and S phase progression. It phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively.
Description of target: NEK9 is a pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. It phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. It is important for G1/S transition and S phase progression. It phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively.
Product Categories/Family for NEK9 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek9 isoform 2
NCBI Official Synonym Full Names
NIMA related kinase 9
NCBI Official Symbol
NEK9
NCBI Official Synonym Symbols
NC; APUG; NERCC; LCCS10; NERCC1
NCBI Protein Information
serine/threonine-protein kinase Nek9
UniProt Protein Name
Serine/threonine-protein kinase Nek9
UniProt Gene Name
NEK9
UniProt Synonym Gene Names
KIAA1995; NEK8; NERCC; NimA-related protein kinase 9; Nek8
UniProt Entry Name
NEK9_HUMAN
Similar Products
Product Notes
The NEK9 nek9 (Catalog #AAA201855) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NEK9 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEK9 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NEK9 nek9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEK9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.