Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

O3FAR1 blocking peptide

O3FAR1 Peptide - C-terminal region

Gene Names
ZC3H12A; Reg1; MCPIP; MCPIP1; MCPIP-1; dJ423B22.1
Reactivity
Human
Applications
Western Blot
Synonyms
O3FAR1; N/A; O3FAR1 Peptide - C-terminal region; GT01, PGR4, BMIQ10, GPR120, GPR129, O3FAR1; O3FAR1 blocking peptide
Ordering
Reactivity
Human
Form/Format
Lyophilized powder
Concentration
1 mg/ml in PBS (varies by lot)
Sequence
VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM
Sequence Length
377
Applicable Applications for O3FAR1 blocking peptide
WB (Western Blot)
Protein Size (# AA)
377 amino acids
Preparation and Storage
For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Related Product Information for O3FAR1 blocking peptide
Description: GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
This is a synthetic peptide designed for use in combination with anti-O3FAR1 Antibody ( MBS3215667 ). It may block aboev mentioned antibody from binding to its target protein in western blot and or immunohistochemistry under proper expiramental settings. There is no guarantee for its use in other applications .
Product Categories/Family for O3FAR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
endoribonuclease ZC3H12A isoform a
NCBI Official Synonym Full Names
zinc finger CCCH-type containing 12A
NCBI Official Symbol
ZC3H12A
NCBI Official Synonym Symbols
Reg1; MCPIP; MCPIP1; MCPIP-1; dJ423B22.1
NCBI Protein Information
endoribonuclease ZC3H12A
UniProt Protein Name
Free fatty acid receptor 4
UniProt Gene Name
FFAR4
UniProt Synonym Gene Names
GPR120; GPR129; O3FAR1; PGR4
UniProt Entry Name
FFAR4_HUMAN

Similar Products

Product Notes

The O3FAR1 ffar4 (Catalog #AAA201845) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The O3FAR1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's O3FAR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the O3FAR1 ffar4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VVTHSEITKA SRKRLTVSLA YSESHQIRVS QQDFRLFRTL FLLMVSFFIM. It is sometimes possible for the material contained within the vial of "O3FAR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.