OR2W3 blocking peptide
OR2W3 Peptide - C-terminal region
Gene Names
OR2W3; OR2W3P; OR2W8P; OST718
Reactivity
Human
Applications
Western Blot
Synonyms
OR2W3; N/A; OR2W3 Peptide - C-terminal region; OR2W3 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL
Sequence Length
314
Applicable Applications for OR2W3 blocking peptide
WB (Western Blot)
Protein size
314 amino acids
Quality control
The peptide is characterized by mass spectroscopy.
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for OR2W3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-OR2W3 Antibody (MBS3218713). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Target Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product Categories/Family for OR2W3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
olfactory receptor 2W3
NCBI Official Synonym Full Names
olfactory receptor family 2 subfamily W member 3
NCBI Official Symbol
OR2W3
NCBI Official Synonym Symbols
OR2W3P; OR2W8P; OST718
NCBI Protein Information
olfactory receptor 2W3
UniProt Protein Name
Olfactory receptor 2W3
UniProt Gene Name
OR2W3
UniProt Synonym Gene Names
OR2W3P; OR2W8P
UniProt Entry Name
OR2W3_HUMAN
Similar Products
Product Notes
The OR2W3 or2w3 (Catalog #AAA201853) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The OR2W3 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OR2W3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OR2W3 or2w3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIYMYMQPGA SSSQDQGMFL MLFYNIVTPL LNPLIYTLRN REVKGALGRL. It is sometimes possible for the material contained within the vial of "OR2W3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.