PRSS1 blocking peptide
PRSS1 Peptide - C-terminal region
Gene Names
PRSS1; TRP1; TRY1; TRY4; TRYP1
Reactivity
Human
Applications
Western Blot
Synonyms
PRSS1; N/A; PRSS1 Peptide - C-terminal region; PRSS1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
FCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVY
Sequence Length
247
Applicable Applications for PRSS1 blocking peptide
WB (Western Blot)
Protein size
247 amino acids
Partner proteins
DEFA5,PTPN4,SERPINA1,SERPINB13,SERPINB8,SERPINF2,SPINK5,TST,SERPINB8,SERPINF2
Quality control
The peptide is characterized by mass spectroscopy
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PRSS1 blocking peptide
Description of target: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.
Description: This is a synthetic peptide designed for use in combination with anti-PRSS1 Antibody (MBS3239950). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Description: This is a synthetic peptide designed for use in combination with anti-PRSS1 Antibody (MBS3239950). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product Categories/Family for PRSS1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
trypsin-1 preproprotein
NCBI Official Synonym Full Names
serine protease 1
NCBI Official Symbol
PRSS1
NCBI Official Synonym Symbols
TRP1; TRY1; TRY4; TRYP1
NCBI Protein Information
trypsin-1
UniProt Protein Name
Trypsin-1
UniProt Gene Name
PRSS1
UniProt Synonym Gene Names
TRP1; TRY1; TRYP1
UniProt Entry Name
TRY1_HUMAN
Similar Products
Product Notes
The PRSS1 prss1 (Catalog #AAA201843) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PRSS1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRSS1 prss1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FCVGFLEGGK DSCQGDSGGP VVCNGQLQGV VSWGDGCAQK NKPGVYTKVY. It is sometimes possible for the material contained within the vial of "PRSS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.