Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

SPSB1 blocking peptide

SPSB1 Peptide - middle region

Gene Names
SPSB1; SSB1; SSB-1
Reactivity
Human
Applications
Western Blot
Synonyms
SPSB1; N/A; SPSB1 Peptide - middle region; SPSB1 blocking peptide
Ordering
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL
Applicable Applications for SPSB1 blocking peptide
WB (Western Blot)
Quality Control
The peptide is characterized by mass spectroscopy
Reconstitution
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS.
Preparation and Storage
For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SPSB1 blocking peptide
Description of Target: SPSB1 is a probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Description of Product: This is a synthetic peptide designed for use in combination with anti-SPSB1 Antibody (MBS3217203). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product Categories/Family for SPSB1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
SPRY domain-containing SOCS box protein 1
NCBI Official Synonym Full Names
splA/ryanodine receptor domain and SOCS box containing 1
NCBI Official Symbol
SPSB1
NCBI Official Synonym Symbols
SSB1; SSB-1
NCBI Protein Information
SPRY domain-containing SOCS box protein 1
UniProt Protein Name
SPRY domain-containing SOCS box protein 1
UniProt Gene Name
SPSB1
UniProt Synonym Gene Names
SSB1; SSB-1
UniProt Entry Name
SPSB1_HUMAN

Similar Products

Product Notes

The SPSB1 spsb1 (Catalog #AAA201851) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SPSB1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPSB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SPSB1 spsb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RGLHVWQITW AMRQRGTHAV VGVATADAPL HSVGYTTLVG NNHESWGWDL. It is sometimes possible for the material contained within the vial of "SPSB1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.