TRBC2 blocking peptide
TRBC2 Peptide - middle region
Gene Names
TRBC2; TCRBC2
Reactivity
Human
Applications
Western Blot
Synonyms
TRBC2; N/A; TRBC2 Peptide - middle region; TRBC2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKP
Sequence Length
310
Applicable Applications for TRBC2 blocking peptide
WB (Western Blot)
Protein Size (# AA)
310 amino acids
Quality Control
The peptide is characterized by mass spectroscopy.
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRBC2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-TRBC2 Antibody. It may block above menntioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product Categories/Family for TRBC2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
T cell receptor beta chain
NCBI Official Synonym Full Names
T cell receptor beta constant 2
NCBI Official Symbol
TRBC2
NCBI Official Synonym Symbols
TCRBC2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TRBC2 (Catalog #AAA201860) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRBC2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRBC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TRBC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PALNDSRYCL SSRLRVSATF WQNPRNHFRC QVQFYGLSEN DEWTQDRAKP. It is sometimes possible for the material contained within the vial of "TRBC2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.