Human IgE receptor subunit A Recombinant Protein
Recombinant human IgE receptor subunit A
Applications
IA (Immunoassay)
Purity
The protein was purified by Nickle column
Synonyms
Human IgE receptor subunit A; N/A; Recombinant human IgE receptor subunit A; Human IgE receptor subunit A recombinant protein
Host
E Coli
Purity/Purification
The protein was purified by Nickle column
Form/Format
Purified, Liquid
PBS with 50mM arginine
PBS with 50mM arginine
Concentration
1.49mg/ml (varies by lot)
Sequence
APAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAP
Applicable Applications for Human IgE receptor subunit A recombinant protein
IA (Immunoassay)
Note
Centrifuge before opening to ensure complete recovery of vial contents.
Preservative
0.05% Sodium azide
Preparation and Storage
Upon receipt, dilute into 1 mg/ml then aliquote, store at 20°C.
Avoid multiple freeze/thaw cycles.
Avoid multiple freeze/thaw cycles.
Related Product Information for Human IgE receptor subunit A recombinant protein
The IgE receptor subunit A(also known as Fce RIA or FceRIA) is a subunit of IgE receptor, present as a transmembrane glycoprotein. IgE receptor is a tetrameric complex consisting of one A, one B and two G subunits on mast cells and basophils. The subunit A is responsible for the binding to IgE, while the G subunit is essential for cell signaling and the B subunit increase the half life of the Fce RI on the cell surface. IgE receptor subunit A is important in some disease, the patients with chronic urticaria has high concentration of circulating autoantibodies that crosslink Fce RIA with IgE. The 201 amino acids full length of human IgE receptor subunit A was expressed in E Coli with a 6 x his tag as its C-terminal.
Similar Products
Product Notes
The Human IgE receptor subunit A (Catalog #AAA77985) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Human IgE receptor subunit A can be used in a range of immunoassay formats including, but not limited to, IA (Immunoassay). Researchers should empirically determine the suitability of the Human IgE receptor subunit A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: APAMESPTLL CVALLFFAPD GVLAVPQKPK VSLNPPWNRI FKGENVTLTC NGNNFFEVSS TKWFHNGSLS EETNSSLNIV NAKEDSGEYK CQHQQVNESE PVYLEVFSDW LLLQASAEVV MEGQPLFLRC HGWRNWDVYK VIYYKDGEAL KYWYENHNIS ITNATVEDSG TYYCTGKVWQ LDYESEPLNI TVIKAP. It is sometimes possible for the material contained within the vial of "Human IgE receptor subunit A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.