Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

SELENOI blocking peptide

SELENOI Peptide - N-terminal region

Gene Names
Selenoi; Ept1; Seli; RGD1560938
Reactivity
Rat, Human
Synonyms
SELENOI; N/A; SELENOI Peptide - N-terminal region; SELENOI blocking peptide
Ordering
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Concentration
1 mg/mL in PBS( after reconstitution) (varies by lot)
Sequence
FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD
Sequence Length
398
Protocol
Reconstitution Instructions
- Immunohistochemistry (IHC) Protocol
-Immunocytochemistry (ICC) Protocol
-Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
-Western Blotting/ Immunoblotting (WB/IB) Protocol
-Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
Reconsitution
Add 100uL of sterile PBS. For longer periods of storage, storage store at -20°C . Avoid repeated freeze/thaw cycles.
Protein Size
398 amino acids
Preparation and Storage
Add 100 uL of sterile PBS. Final peptide concentration is 1 mg/mL in PBS. For longer periods of storage, store at -20°C . Avoid repeat freeze-thaw cycles.
Related Product Information for SELENOI blocking peptide
The multi-pass transmembrane protein encoded by this gene belongs to the CDP-alcohol phosphatidyltransferase class-I family. It catalyzes the transfer of phosphoethanolamine from CDP-ethanolamine to diacylglycerol to produce phosphatidylethanolamine, which is involved in the formation and maintenance of vesicular membranes, regulation of lipid metabolism, and protein folding. This protein is a selenoprotein, containing the rare selenocysteine (Sec) amino acid at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.
Product Categories/Family for SELENOI blocking peptide

NCBI and Uniprot Product Information

NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
Protein
NCBI Official Synonym Full Names
selenoprotein I
NCBI Official Symbol
Selenoi
NCBI Official Synonym Symbols
Ept1; Seli; RGD1560938
NCBI Protein Information
ethanolaminephosphotransferase 1

Similar Products

Product Notes

The SELENOI (Catalog #AAA201831) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SELENOI Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: FMLLVFNFLL LTYFDPDFYA SAPGHKHVPD WVWIVVGILN FVAYTLDGVD. It is sometimes possible for the material contained within the vial of "SELENOI, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.