Interferon alpha-21 Recombinant Protein | IFNA21 recombinant protein
Recombinant Human Interferon alpha-21
Gene Names
IFNA21; LeIF F; leIF-F; IFN-alphaI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon alpha-21; N/A; Recombinant Human Interferon alpha-21; Interferon alpha-F; LeIF F; IFNA21 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-189aa; Full Length of Mature Protein
Sequence
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for IFNA21 recombinant protein
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Product Categories/Family for IFNA21 recombinant protein
References
The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) A new type of leukocytic interferon.Gren E.Y., Berzin V.M., Tsimanis A.Y., Apsalon U.R., Vishnevskii Y.I., Yansone I.V., Dishler A.V., Pudova N.V., Smorodintsev A.A., Iovlev V.I., Stepanov A.N., Feldmane G.Y., Meldrais Y.A., Lozha V.P., Kavsan V.M., Efimov V.A., Sverdlov E.D.Dokl. Biochem. 269:91-95(1983) Novel human leukocyte interferon subtype and structural comparison of alpha interferon genes.Gren E., Berzin V.M., Jansone I., Tsimanis A., Vishnevsky Y., Apsalons U.J. Interferon Res. 4:609-617(1984) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21.3 kDa
NCBI Official Full Name
interferon alpha-21
NCBI Official Synonym Full Names
interferon, alpha 21
NCBI Official Symbol
IFNA21
NCBI Official Synonym Symbols
LeIF F; leIF-F; IFN-alphaI
NCBI Protein Information
interferon alpha-21
UniProt Protein Name
Interferon alpha-21
UniProt Gene Name
IFNA21
UniProt Synonym Gene Names
IFN-alpha-21; LeIF F
UniProt Entry Name
IFN21_HUMAN
Similar Products
Product Notes
The IFNA21 ifna21 (Catalog #AAA114110) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-189aa; Full Length of Mature Protein. The amino acid sequence is listed below: CDLPQTHSLG NRRALILLAQ MGRISPFSCL KDRHDFGFPQ EEFDGNQFQK AQAISVLHEM IQQTFNLFST KDSSATWEQS LLEKFSTELN QQLNDLEACV IQEVGVEETP LMNVDSILAV KKYFQRITLY LTEKKYSPCA WEVVRAEIMR SFSLSKIFQE RLRRKE. It is sometimes possible for the material contained within the vial of "Interferon alpha-21, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
