Application Data
(Recombinant Human IFN-alpha 21/IFNA21 Protein cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 0.50?1.98 ng/mL, corresponding to a specific activity of 5.05×10<sup>5</sup>~2.00×10<sup>6</sup> units/mg.)
IFN-alpha 21 Recombinant Protein | IFNA21 recombinant protein
Recombinant Human IFN-alpha 21 Protein
Synonyms
IFN-alpha 21; N/A; Recombinant Human IFN-alpha 21 Protein; IFNA21; IFNalpha F; IFN-alpha F; IFN-alpha-21; IFN-alphaI; interferon alpha-21; Interferon alpha-F; interferon, alpha 21; LeIF F; leukocyte interferon protein; MGC126687; MGC126689; IFNA21 recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Species
Human
Tag
C-His
Endotoxin
<0.01EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.50?1.98ng/mL, corresponding to a specific activity of 5.05×105~2.00×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Human IFN-alpha 21/IFNA21 Protein cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 0.50?1.98 ng/mL, corresponding to a specific activity of 5.05×10<sup>5</sup>~2.00×10<sup>6</sup> units/mg.)
Application Data
(Recombinant Human IFN-alpha 21/IFNA21 Protein cytotoxicity assay using TF-1 cells. The ED<sub>50</sub> for this effect is 0.50?1.98 ng/mL, corresponding to a specific activity of 5.05×10<sup>5</sup>~2.00×10<sup>6</sup> units/mg.)
SDS-PAGE
(Recombinant Human IFN-alpha 21/IFNA21 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20-25 KD.)
SDS-PAGE
(Recombinant Human IFN-alpha 21/IFNA21 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20-25 KD.)
Related Product Information for IFNA21 recombinant protein
Interferons (IFN) are a family of cytokines with potent antiviral, anti-proliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early '80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology. Structurally, type I IFNs belong to the class of five helical bundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. There is not a mouse homolog for IFNA21, but mature human IFNA21 is identical to chimpanzee IFNA21. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, with IFNA21 displaying intermediate activity inducing interferon stimulating genes. Further, human IFNA21 has shown weak anti-viral activity against viruses such as metapneumovirus.
Product Categories/Family for IFNA21 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Protein Name
Interferon alpha-21
UniProt Gene Name
IFNA21
UniProt Synonym Gene Names
IFN-alpha-21; LeIF F
Similar Products
Product Notes
The IFNA21 ifna21 (Catalog #AAA283388) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CDLPQTHSLG NRRALILLAQ MGRISPFSCL KDRHDFGFPQ EEFDGNQFQK AQAISVLHEM IQQTFNLFST KDSSATWEQS LLEKFSTELN QQLNDLEACV IQEVGVEETP LMNVDSILAV KKYFQRITLY LTEKKYSPCA WEVVRAEIMR SFSLSKIFQE RLRRKE. It is sometimes possible for the material contained within the vial of "IFN-alpha 21, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.