IL-11 recombinant protein

Recombinant Mouse IL-11 Protein

Cat. Num. AAA283398

• Synonyms: IL-11; N/A; Recombinant Mouse IL-11 Protein; IL11; IL-11Oprelvekin; interleukin 11; interleukin-11; Oprelvekin; IL-11 recombinant protein

• Host: E coli
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

• Species: Mouse
• Tag: No tag
• Endotoxin: <1EU/ug
• Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED₅₀ for this effect is 2.64-10.56ng/mL, corresponding to a specific activity of 9.47×10⁴~3.79×10⁵ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL-11 promotes the proliferation assay using TF-1 Human erythroleukemic cells. The ED₅₀ for this effect is 2.64-10.56 ng/mL, corresponding to a specific activity of 9.47×10⁴~3.79×10⁵ units/mg.)

SDS-PAGE

(Recombinant Mouse IL-11 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 kDa.)

Related Product Information for IL-11 recombinant protein

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family, which also includes LIF, CNTF, Oncostatin M, Cardiotrophin-1, IL-27 and IL-31 (1-4). In humans, IL-11 was also independently discovered as an adipogenesis inhibitory factor (AGIF)(3). The mouse IL-11 cDNA encodes a 199 amino acid (aa) precursor, which generates a 178 aa, 19 kDa mature unglycosylated protein. Mature mouse IL-11 shares 88%, 97%, and 89% aa sequence identity with human, rat and canine IL-11, respectively. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types (1). It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti-inflammatory (1). It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine (1). It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis (1). IL-11 synergizes with several other cytokines to produce these effects, and its effects overlap with those of IL-6 (1). IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 R alpha subunit and two molecules of the ubiquitously expressed cell signaling beta subunit, gp130 (5). A soluble form of IL-11 R alpha can bind IL-11 and either form a signaling complex with gp130 on the cell surface, or inhibit cell surface IL-11 R alpha /gp130 signaling (6-8).

Product Categories/Family for IL-11 recombinant protein

Other Recombinant Protein; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 6680393
• NCBI GeneID: 16156
• NCBI Accession #: NP_032376.1
• NCBI GenBank Nucleotide #: NM_008350.4
• UniProt Accession #: P47873
• UniProt Protein Name: Interleukin-11
• UniProt Gene Name: Il11
• UniProt Synonym Gene Names: IL-11
• UniProt Entry Name: IL11_MOUSE