Application Data
(Recombinant Mouse IL-18 induce IFN-gamma secretion by KG 1 human acute myelogenous leukemia cells in the presence of TNF-alpha . The ED<sub>50</sub> for this effect is 42.93-171.72 ng/mL, corresponding to a specific activity of 0.58×10<sup>4</sup>~2.3×10<sup>5</sup> units/mg.)
IL-18 recombinant protein
Recombinant Mouse IL-18 Protein
Purity
>98% by SDS-PAGE.
Synonyms
IL-18; N/A; Recombinant Mouse IL-18 Protein; Ig, Il-, Igif, Il-18, IL18; IL-18 recombinant protein
Host
HEK293 cells
Purity/Purification
>98% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH8.0.
Sequence
NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Species
Mouse
Tag
C-His
Endotoxin
<0.1EU/ug
Bio-Activity
Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha . The ED50 for this effect is 42.93-171.72ng/mL, corresponding to a specific activity of 0.58×104~2.3×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Mouse IL-18 induce IFN-gamma secretion by KG 1 human acute myelogenous leukemia cells in the presence of TNF-alpha . The ED<sub>50</sub> for this effect is 42.93-171.72 ng/mL, corresponding to a specific activity of 0.58×10<sup>4</sup>~2.3×10<sup>5</sup> units/mg.)
Application Data
(Recombinant Mouse IL-18 induce IFN-gamma secretion by KG 1 human acute myelogenous leukemia cells in the presence of TNF-alpha . The ED<sub>50</sub> for this effect is 42.93-171.72 ng/mL, corresponding to a specific activity of 0.58×10<sup>4</sup>~2.3×10<sup>5</sup> units/mg.)
SDS-PAGE
(Recombinant Mouse IL-18 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 kDa.)
SDS-PAGE
(Recombinant Mouse IL-18 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 kDa.)
Related Product Information for IL-18 recombinant protein
Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-gamma (IFN-gamma) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Product Categories/Family for IL-18 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interleukin-18
UniProt Gene Name
Il18
UniProt Synonym Gene Names
Igif; IL-18; IFN-gamma-inducing factor; IL-1 gamma
UniProt Entry Name
IL18_MOUSE
Similar Products
Product Notes
The IL-18 il18 (Catalog #AAA283380) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: NFGRLHCTTA VIRNINDQVL FVDKRQPVFE DMTDIDQSAS EPQTRLIIYM YKDSEVRGLA VTLSVKDSKM STLSCKNKII SFEEMDPPEN IDDIQSDLIF FQKRVPGHNK MEFESSLYEG HFLACQKEDD AFKLILKKKD ENGDKSVMFT LTNLHQS. It is sometimes possible for the material contained within the vial of "IL-18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.