Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116151_SDS_PAGE15.jpg SDS-PAGE

Interleukin-18 Recombinant Protein | Il18bp recombinant protein

Recombinant Mouse Interleukin-18-binding protein

Average rating 0.0
No ratings yet
Gene Names
Il18bp; MC54L; Igifbp; IL-18BP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-18; N/A; Recombinant Mouse Interleukin-18-binding protein; Interferon gamma-inducing factor-binding protein; Il18bp recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
29-193aa; Full Length of Mature Protein
Sequence
TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116151_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Il18bp recombinant protein
Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
References
Cloning and expression of interleukin-18 binding protein.Aizawa Y., Akita K., Taniai M., Torigoe K., Mori T., Nishida Y., Ushio S., Nukada Y., Tanimoto T., Ikegami H., Ikeda M., Kurimoto M.FEBS Lett. 445:338-342(1999) Interleukin-18 binding protein a novel modulator of the Th1 cytokine response.Novick D., Kim S.-H., Fantuzzi G., Reznikov L.L., Dinarello C.A., Rubinstein M.Immunity 10:127-136(1999) Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus.Xiang Y., Moss B.Virology 257:297-302(1999) Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201) .Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B.Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
interleukin-18-binding protein
NCBI Official Synonym Full Names
interleukin 18 binding protein
NCBI Official Symbol
Il18bp
NCBI Official Synonym Symbols
MC54L; Igifbp; IL-18BP
NCBI Protein Information
interleukin-18-binding protein
UniProt Protein Name
Interleukin-18-binding protein
UniProt Gene Name
Il18bp
UniProt Synonym Gene Names
Igifbp; IL-18BP
UniProt Entry Name
I18BP_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Il18bp il18bp (Catalog #AAA116151) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-193aa; Full Length of Mature Protein. The amino acid sequence is listed below: TSAPQTTATV LTGSSKDPCS SWSPAVPTKQ YPALDVIWPE KEVPLNGTLT LSCTACSRFP YFSILYWLGN GSFIEHLPGR LKEGHTSREH RNTSTWLHRA LVLEELSPTL RSTNFSCLFV DPGQVAQYHI ILAQLWDGLK TAPSPSQETL SSHSPVSRSA GPGVA. It is sometimes possible for the material contained within the vial of "Interleukin-18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.