IL-1Ra/IL-1F3/IL-1RN Recombinant Protein | IL1RN recombinant protein

Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein

Cat. Num. AAA283370

• Purity: >92% by SDS-PAGE.
• Synonyms: IL-1Ra/IL-1F3/IL-1RN; N/A; Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein; IL-1ra;il1ra;il-1ra;IL1RA; IL1RN recombinant protein

• Host: E coli
• Purity/Purification: >92% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
• Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ

• Species: Rat
• Endotoxin: <1EU/ug
• Bio-Activity: Measured by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 mouse helper T cells. The ED₅₀ for this effect is 2.62-10.48ng/mL in the presence of 50 pg/mL of rrIL-1 alpha(Catalog: RP01736), corresponding to a specific activity of 9.54×10⁴~3.82×10⁵ units/mg.
• Preparation and Storage: Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Rat IL-1Ra/IL-1F3/IL-1RN inhibit IL-1 alpha-dependent proliferation in D10.G4.1 mouse helper T cells. The ED₅₀ for this effect is 2.62-10.48 ng/mL in the presence of 50 pg/mL of rrIL-1 alpha , corresponding to a specific activity of 9.54×10⁴~3.82×10⁵ units/mg.)

SDS-PAGE

(Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15-25 kDa.)

Related Product Information for IL1RN recombinant protein

Interleukin-1 receptor antagonist (IL-1RA) also known as IL1RN is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A), and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. A polymorphism of this protein-encoding gene is reported to be associated with an increased risk of osteoporotic fractures and gastric cancer. IL-1RA/IL1RN may inhibit the activity of IL-1 by binding to its receptor and it has no IL-1 like activity. Genetic variation in IL-1RA/IL1RN is associated with susceptibility to microvascular complications of diabetes type 4 (MVCD4). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in IL-1RA/IL1RN are the cause of interleukin 1 receptor antagonist deficiency (DIRA) which is also known as deficiency of interleukin 1 receptor antagonist. Autoinflammatory diseases manifest inflammation without evidence of infection, high-titer autoantibodies, or autoreactive T-cells. DIRA is a rare, autosomal recessive, genetic autoinflammatory disease that results in sterile multifocal osteomyelitis, and pustulosis from birth.

Product Categories/Family for IL1RN recombinant protein

Cytokines & Cytokine receptors; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 11559964
• NCBI GeneID: 60582
• NCBI Accession #: NP_071530.1
• NCBI GenBank Nucleotide #: NM_022194.2
• UniProt Accession #: P25086
• UniProt Protein Name: Interleukin-1 receptor antagonist protein
• UniProt Gene Name: Il1rn
• UniProt Synonym Gene Names: Il-1ra; IL-1RN; IL-1ra; IRAP
• UniProt Entry Name: IL1RA_RAT