Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283399_AD13.jpg Application Data (Recombinant Mouse IL-22 induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED<sub>50</sub> for this effect is 0.1-0.4 ng/mL, corresponding to a specific activity of 2.5×10<sup>6</sup>~1.0×10<sup>7</sup> units/mg.)

IL-22 recombinant protein

Recombinant Mouse IL-22 Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
IL-22; N/A; Recombinant Mouse IL-22 Protein; If2b1; Iltif; IL-22a; ILTIFa; IL-22 recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Species
Mouse
Tag
C-His
Endotoxin
<0.01EU/ug
Bio-Activity
Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 0.1-0.4ng/mL, corresponding to a specific activity of 2.5×106~1.0×107 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL-22 induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED<sub>50</sub> for this effect is 0.1-0.4 ng/mL, corresponding to a specific activity of 2.5×10<sup>6</sup>~1.0×10<sup>7</sup> units/mg.)

product-image-AAA283399_AD13.jpg Application Data (Recombinant Mouse IL-22 induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED<sub>50</sub> for this effect is 0.1-0.4 ng/mL, corresponding to a specific activity of 2.5×10<sup>6</sup>~1.0×10<sup>7</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse IL-22 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)

product-image-AAA283399_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse IL-22 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)
Related Product Information for IL-22 recombinant protein
Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10Rbeta (previously known as CRF2-4), belonging to the class II cytokine receptor family.
Product Categories/Family for IL-22 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interleukin-22
UniProt Gene Name
Il22
UniProt Synonym Gene Names
Il22a; Iltif; Iltifa; IL-22; IL-TIF; IL-22a
UniProt Entry Name
IL22_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL-22 il22 (Catalog #AAA283399) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LPVNTRCKLE VSNFQQPYIV NRTFMLAKEA SLADNNTDVR LIGEKLFRGV SAKDQCYLMK QVLNFTLEDV LLPQSDRFQP YMQEVVPFLT KLSNQLSSCH ISGDDQNIQK NVRRLKETVK KLGESGEIKA IGELDLLFMS LRNACV. It is sometimes possible for the material contained within the vial of "IL-22, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.