Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283371_AD13.jpg Application Data (Recombinant Human IL-25/IL-17E induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED<sub>50</sub> for this effect is 5.46-21.84ng/mL, corresponding to a specific activity of 4.58×10<sup>4</sup>~1.83×10<sup>5</sup> units/mg.)

IL-25/IL-17E Recombinant Protein | IL25 recombinant protein

Recombinant Human IL-25/IL-17E Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
IL-25/IL-17E; N/A; Recombinant Human IL-25/IL-17E Protein; IL17E; IL-17E; IL25; IL-25; interleukin 25; Interleukin-17E; interleukin-25; IL25 recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Species
Human
Tag
N-6His
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 5.46-21.84ng/mL, corresponding to a specific activity of 4.58×104~1.83×105 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Human IL-25/IL-17E induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED<sub>50</sub> for this effect is 5.46-21.84ng/mL, corresponding to a specific activity of 4.58×10<sup>4</sup>~1.83×10<sup>5</sup> units/mg.)

product-image-AAA283371_AD13.jpg Application Data (Recombinant Human IL-25/IL-17E induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED<sub>50</sub> for this effect is 5.46-21.84ng/mL, corresponding to a specific activity of 4.58×10<sup>4</sup>~1.83×10<sup>5</sup> units/mg.)

SDS-PAGE

(Recombinant Human IL-25/IL-17E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20-30 kDa.)

product-image-AAA283371_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human IL-25/IL-17E Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20-30 kDa.)
Related Product Information for IL25 recombinant protein
Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17-producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity. IL-25 promotes cell expansion and Th2 cytokine production when Th2 central memory cells are stimulated with thymic stromal lymphopoietin (TSLP)-activated dendritic cells (DCs), homeostatic cytokines, or T cell receptor for antigen triggering. Elevated expression of IL-25 and IL-25R transcripts was observed in asthmatic lung tissues and atopic dermatitis skin lesions, linking their possible roles with exacerbated allergic disorders. A plausible explanation that IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of adaptive Th2 memory cells had been provided.
Product Categories/Family for IL25 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interleukin-25
UniProt Gene Name
IL25
UniProt Synonym Gene Names
IL17E; IL-25; IL-17E
UniProt Entry Name
IL25_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL25 il25 (Catalog #AAA283371) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: YSHWPSCCPS KGQDTSEELL RWSTVPVPPL EPARPNRHPE SCRASEDGPL NSRAISPWRY ELDRDLNRLP QDLYHARCLC PHCVSLQTGS HMDPRGNSEL LYHNQTVFYR RPCHGEKGTH KGYCLERRLY RVSLACVCVR PRVMG. It is sometimes possible for the material contained within the vial of "IL-25/IL-17E, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.