Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283363_AD13.jpg Application Data (Recombinant Mouse IL36G induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells. Towne, J.E. et al. (2004) J. Biol. Chem. 279:13677. The ED <sub>50 </sub> for this effect is 0.1-0.4 ug/mL,corresponding to a specific activity of 2.5×10<sup>3</sup>~1×10<sup>4</sup> units/mg.)

IL-36 gamma/IL-1F9 Recombinant Protein | IL36G recombinant protein

Recombinant Mouse IL-36 gamma/IL-1F9 Protein

Average rating 0.0
No ratings yet
Purity
>95% by SDS-PAGE.
Synonyms
IL-36 gamma/IL-1F9; N/A; Recombinant Mouse IL-36 gamma/IL-1F9 Protein; If36g; Il1f9; IL-36gamma; IL36G recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
Species
Mouse
Tag
C-His
Endotoxin
<0.01EU/ug
Bio-Activity
Measured by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells. Towne, J.E. et al. (2004) J. Biol. Chem. 279:13677. The ED 50 for this effect is 0.1-0.4ug/mL, corresponding to a specific activity of 2.5×103~1×104 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(Recombinant Mouse IL36G induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells. Towne, J.E. et al. (2004) J. Biol. Chem. 279:13677. The ED <sub>50 </sub> for this effect is 0.1-0.4 ug/mL,corresponding to a specific activity of 2.5×10<sup>3</sup>~1×10<sup>4</sup> units/mg.)

product-image-AAA283363_AD13.jpg Application Data (Recombinant Mouse IL36G induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells. Towne, J.E. et al. (2004) J. Biol. Chem. 279:13677. The ED <sub>50 </sub> for this effect is 0.1-0.4 ug/mL,corresponding to a specific activity of 2.5×10<sup>3</sup>~1×10<sup>4</sup> units/mg.)

SDS-PAGE

(Recombinant Mouse Interleukin-36 gamma/IL36G Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20 kDa.)

product-image-AAA283363_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse Interleukin-36 gamma/IL36G Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 20 kDa.)
Related Product Information for IL36G recombinant protein
The protein is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.
Product Categories/Family for IL36G recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
UniProt Protein Name
Interleukin-36 gamma
UniProt Gene Name
Il36g
UniProt Synonym Gene Names
Il1f9; IL-1F9
UniProt Entry Name
IL36G_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IL36G il36g (Catalog #AAA283363) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GRETPDFGEV FDLDQQVWIF RNQALVTVPR SHRVTPVSVT ILPCKYPESL EQDKGIAIYL GIQNPDKCLF CKEVNGHPTL LLKEEKILDL YHHPEPMKPF LFYHTRTGGT STFESVAFPG HYIASSKTGN PIFLTSKKGE YYNINFNLDI KS. It is sometimes possible for the material contained within the vial of "IL-36 gamma/IL-1F9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.