Application Data
(Recombinant Human IL-9 Protein promote the proliferation of M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0.28-1.12 ng/mL, corresponding to a specific activity of 8.9×10<sup>5</sup>~3.6×10<sup>6</sup> units/mg.)
IL-9 Recombinant Protein | IL9 recombinant protein
Recombinant Human IL-9 Protein
Synonyms
IL-9; N/A; Recombinant Human IL-9 Protein; P40; HP40; IL9; IL9 recombinant protein
Host
HEK293 cells
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Species
Human
Endotoxin
<0.1EU/ug of the protein by LAL method.
Bio-Activity
Measured in a cell proliferation assay using M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0.28-1.12ng/mL, corresponding to a specific activity of 8.9×105~3.6×106 units/mg.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
Application Data
(Recombinant Human IL-9 Protein promote the proliferation of M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0.28-1.12 ng/mL, corresponding to a specific activity of 8.9×10<sup>5</sup>~3.6×10<sup>6</sup> units/mg.)
Application Data
(Recombinant Human IL-9 Protein promote the proliferation of M07e human megakaryocytic leukemic cells. The ED50 for this effect is 0.28-1.12 ng/mL, corresponding to a specific activity of 8.9×10<sup>5</sup>~3.6×10<sup>6</sup> units/mg.)
SDS-PAGE
(Recombinant Human IL-9 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-40 KD.)
SDS-PAGE
(Recombinant Human IL-9 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 25-40 KD.)
Related Product Information for IL9 recombinant protein
Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.
Product Categories/Family for IL9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Interleukin-9
UniProt Gene Name
IL9
UniProt Synonym Gene Names
IL-9
UniProt Entry Name
IL9_HUMAN
Similar Products
Product Notes
The IL9 il9 (Catalog #AAA283411) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QGCPTLAGIL DINFLINKMQ EDPASKCHCS ANVTSCLCLG IPSDNCTRPC FSERLSQMTN TTMQTRYPLI FSRVKKSVEV LKNNKCPYFS CEQPCNQTTA GNALTFLKSL LEIFQKEKMR GMRGKI. It is sometimes possible for the material contained within the vial of "IL-9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.