SDS-PAGE
Inhibin Beta B Recombinant Protein | INHbB recombinant protein
Recombinant Human Inhibin Beta B (INHbB)
Gene Names
inhbb; inhibin
Applications
ELISA, Western Blot
Purity
>90 % as determined by SDS-PAGEAffinity purification
Synonyms
Inhibin Beta B; N/A; Recombinant Human Inhibin Beta B (INHbB); Activin AB Beta Polypeptide; INHbB recombinant protein
Host
Yeast
Purity/Purification
>90 % as determined by SDS-PAGE
Affinity purification
Affinity purification
Form/Format
Lyophilized Powder
Sequence
ECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG
Sequence Length
370
Applicable Applications for INHbB recombinant protein
ELISA, WB (Western Blot)
Species of Origin
Human
Endotoxin
<1.0 EU per mug of th protein as determined by the LAL method
Storage Buffer
Lyophilized from sterile 20mM NaCI , pH 6.0
Preparation and Storage
Store it under sterile conditions at -20 degree C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
The recombinant protein is stable up to 6-12 months from date of receipt at -80°C
Avoid repeated freeze-thaw cycles.
The recombinant protein is stable up to 6-12 months from date of receipt at -80°C
Avoid repeated freeze-thaw cycles.
SDS-PAGE
SDS-PAGE
Related Product Information for INHbB recombinant protein
Inhibin, beta B is a protein which in humans is encoded by the INHBB gene.INHBB is a subunit of both activin and inhibin, two closely related glycoproteins with opposing biological effects.Inhibins are heterodimeric glycoproteins composed of an alpha subunit (INHA) and one of two homologous, but distinct, beta subunits (betaA or betaB, this protein). mRNA for the two subunits has been demonstrated in the testes of adult rats.Inhibin can bind specifically to testicular interstitial cells throughout development and may be an important regulator of Leydig cell testosterone production or interstitial cell function.The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14.3kDa
NCBI Official Full Name
inhibin, beta B
NCBI Official Synonym Full Names
inhibin, beta B<
NCBI Official Symbol
inhbb
NCBI Official Synonym Symbols
inhibin
NCBI Protein Information
inhibin, beta B; activin B; activin beta B subunit
Similar Products
Product Notes
The INHbB (Catalog #AAA55772) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Inhibin Beta B can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the INHbB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ECDGRTNLCC RQQFFIDFRL IGWNDWIIAP TGYYGNYCEG SCPAYLAGVP GSASSFHTAV VNQYRMRGLN PGTVNSCCIP TKLSTMSMLY FDDEYNIVKR DVPNMIVEEC G. It is sometimes possible for the material contained within the vial of "Inhibin Beta B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.