Adiponectin (Acrp30) Active Protein | ACRP30 active protein
Mouse Adiponectin (Acrp30)
Gene Names
Adipoq; APN; Acdc; apM1; 30kDa; GBP28; adipo; Acrp30
Purity
> 98% by SDS-PAGE gel and HPLC analyses.
Synonyms
Adiponectin (Acrp30); N/A; Mouse Adiponectin (Acrp30); Adipoq; APN; Acdc; apM1; 30 kDa; GBP28; adipo; Acrp30; ACRP30 active protein
Host
Insect Cells
Purity/Purification
> 98% by SDS-PAGE gel and HPLC analyses.
Form/Format
Lyophilized; 20 mM Tris, pH 8.5 + 75mM L-Arginine.
Sequence
RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDG RDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEA AYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGL YYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEV GDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Sequence Length
247
Endotoxin Level
<0.1 ng/ug of protein (<1EU/ug).
Reconstitution
Centrifuge before opening to ensure complete recovery of vial contents. Reconstitute in water to a concentration of 1.0 mg/m. Do Not Vortex. Allow the reconstitutes vial to sit at room temperature for 30 minutes before use. This solution can be stored for up 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag
His-Tag
Length (aa)
236
Preparation and Storage
The lyophilized is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20° to -80°C.
Related Product Information for ACRP30 active protein
Adiponectin is an adipose-derived secreted protein containing 236 amino acid residues. It is relatively abundant in humans and rodents, accounting for about 0.01% of total plasma protein. The circulating levels of adiponectin are decreased under conditions of obesity, insulin resistance, and type II diabetes. Disruption of adiponectin in mice causes insulin resistance and neointimal formation. Conversely, administration of recombinant adiponectin suppresses hepatic glucose production, and reverses insulin resistance associated with both lipoatrophy and obesity. The protective role of adiponectin is attributed to its anti-inflammatory properties (e.g. ability to suppress expression of TNF-beta and class A scavenger receptor in macrophages). Recombinant adiponectin is a multimeric glycoprotein containing amino acids Val-21 to Asn-247 of the adiponectin precursor protein fused to an N-terminal histidine tag. Monomeric glycosylated adiponectin migrates at an apparent molecular weight of approximately 31-36 kDa by SDS PAGE analysis under reducing conditions.
Product Categories/Family for ACRP30 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31-36 kDa
NCBI Official Full Name
adiponectin
NCBI Official Synonym Full Names
adiponectin, C1Q and collagen domain containing
NCBI Official Symbol
Adipoq
NCBI Official Synonym Symbols
APN; Acdc; apM1; 30kDa; GBP28; adipo; Acrp30
NCBI Protein Information
adiponectin; adipocyte-specific protein AdipoQ; adipocyte complement related protein; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein
UniProt Protein Name
Adiponectin
UniProt Gene Name
Adipoq
UniProt Synonym Gene Names
Acdc; Acrp30; Apm1; ACRP30
UniProt Entry Name
ADIPO_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ACRP30 adipoq (Catalog #AAA79239) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RGHHHHHHHH VTTTEELAPA LVPPPKGTCA GWMAGIPGHP GHNGTPGRDG RDGTPGEKGE KGDAGLLGPK GETGDVGMTG AEGPRGFPGT PGRKGEPGEA AYVYRSAFSV GLETRVTVPN VPIRFTKIFY NQQNHYDGST GKFYCNIPGL YYFSYHITVY MKDVKVSLFK KDKAVLFTYD QYQEKNVDQA SGSVLLHLEV GDQVWLQVYG DGDHNGLYAD NVNDSTFTGF LLYHDTN. It is sometimes possible for the material contained within the vial of "Adiponectin (Acrp30), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.