ELISA
(Figure 2. PlGF Sandwich-ELISA using recombinant human PlGF-1 as standard. Mouse anti-human PlGF #178/G10 was used as capture antibody, Biotinylated rabbit anti-human PlGF was used for detection.)
PlGF-1 active protein
Human PlGF-1
Gene Names
PGF; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
Reactivity
Human
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
PlGF-1; N/A; Human PlGF-1; Recombinant Human Placenta Growth Factor-1; PlGF; Placenta Growth Factor; PlGF-1 active protein
Host
Insect Cells
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Sterile filtered protein solution was lyophilized from 50 mM acetic acid; contains 50x BSA as stabilizer
Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAPRR
Sequence Length
131
Reconstitution
Centrifuge the vial prior to opening. Do not vortex. The lyophilized PIGF-1 should be reconstitutedin 50 mM acetic acid to a concentration of 0.1-1.0 mg/ml
Preparation and Storage
| Product Form | Temperature | Storage Time |
|---|---|---|
| Lyophilized | -20°C to -80°C | 1 year |
| Lyophilized | 2°C to 8°C | 6 months |
| Lyophilized | Room Temperature | 1 month |
| Reconstituted | 2°C to 8°C | 1 week |
| Extended Storage | -20°C to -80°C | 3 months |
ELISA
(Figure 2. PlGF Sandwich-ELISA using recombinant human PlGF-1 as standard. Mouse anti-human PlGF #178/G10 was used as capture antibody, Biotinylated rabbit anti-human PlGF was used for detection.)
ELISA
(Figure 2. PlGF Sandwich-ELISA using recombinant human PlGF-1 as standard. Mouse anti-human PlGF #178/G10 was used as capture antibody, Biotinylated rabbit anti-human PlGF was used for detection.)
SDS-PAGE
(Fig. 1: SDS-PAGE analysis of recombinant human PlGF-1. Samples were loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue.)
SDS-PAGE
(Fig. 1: SDS-PAGE analysis of recombinant human PlGF-1. Samples were loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue.)
Related Product Information for PlGF-1 active protein
Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversial. In several reports it was shown not to be a potent mitogen for endothelial cells and not angiogenic in vivo by using different assays. Very recently it was shown by one investigator, that PlGF-1 from cell culture supernatants was angiogenic in the CAM assay and in the rabbit cornea assay. At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes) but PlGF does not bind to KDR/flk-1. Two different proteins can be generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF-1 is a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses a similar biological profile. There is good evidence that heterodimeric molecules between VEGF and PlGF exists and that they are biological active. Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A very related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.
Product Categories/Family for PlGF-1 active protein
References
1. DiPalma, T. et al. (1996) Mamm. Genome 7:6. 2. Cao, Y. et al. (1997) Biochem. Biophys. Res. Commun. 235:493. 3. Ferrara, N. et al. (1997) Endocrin. Rev. 18:4 4. Kim KJ et al, Exp Mol Med 44:10-9, 2012 5. De Falco S, Exp Mol Med 44:1-9, 2012
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
~34 kDa (Dimer)
NCBI Official Full Name
placenta growth factor isoform 2
NCBI Official Synonym Full Names
placental growth factor
NCBI Official Symbol
PGF
NCBI Official Synonym Symbols
PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
NCBI Protein Information
placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein
UniProt Protein Name
Placenta growth factor
UniProt Gene Name
PGF
UniProt Synonym Gene Names
PGFL; PLGF; PlGF
UniProt Entry Name
PLGF_HUMAN
Similar Products
Product Notes
The PlGF-1 pgf (Catalog #AAA79156) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Human PlGF-1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: LPAVPPQQWA LSAGNGSSEV EVVPFQEVWG RSYCRALERL VDVVSEYPSE VEHMFSPSCV SLLRCTGCCG DENLHCVPVE TANVTMQLLK IRSGDRPSYV ELTFSQHVRC ECRPLREKMK PERCGDAPRR. It is sometimes possible for the material contained within the vial of "PlGF-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.