Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79231_AD13.jpg Application Data

VEGF164 active protein

Mouse VEGF164

Gene Names
Vegfa; Vpf; Vegf
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
VEGF164; N/A; Mouse VEGF164; Recombinant Mouse Vascular Endothelial Growth Factor164; VEGF-A; VPF; VEGF164 active protein
Ordering
Host
Insect Cells
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSC VPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSR CECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQL ELNERTCRCDKPRR
Sequence Length
392
N Terminal Sequence
APTTEGE
Biological Activity
The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for VEGF164 has been determined to be in the range of 1-5 ng/ml.
Reconstitution
The lyophilized VEGF164 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted VEGF164 should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles!

Application Data

product-image-AAA79231_AD13.jpg Application Data

Application Data

product-image-AAA79231_AD15.jpg Application Data
Related Product Information for VEGF164 active protein
Mouse Vascular Endothelial Growth Factor164 (VEGF164), a 24 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF164, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least three different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogeneity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exists and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.
Product Categories/Family for VEGF164 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,283 Da
NCBI Official Full Name
vascular endothelial growth factor A isoform 1
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
Vegfa
NCBI Official Synonym Symbols
Vpf; Vegf
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
Vegfa
UniProt Synonym Gene Names
Vegf; VEGF-A; VPF
UniProt Entry Name
VEGFA_MOUSE

Similar Products

Product Notes

The VEGF164 vegfa (Catalog #AAA79231) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Mouse VEGF164 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: APTTEGEQKS HEVIKFMDVY QRSYCRPIET LVDIFQEYPD EIEYIFKPSC VPLMRCAGCC NDEALECVPT SESNITMQIM RIKPHQSQHI GEMSFLQHSR CECRPKKDRT KPENHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL ELNERTCRCD KPRR. It is sometimes possible for the material contained within the vial of "VEGF164, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.