Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79147_AD13.jpg Application Data

PlGF active protein

Rat PlGF

Average rating 0.0
No ratings yet
Gene Names
Pgf; Plgf
Reactivity
Rat
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
PlGF; N/A; Rat PlGF; Recombinant Rat Placenta Growth Factor; Placenta Growth Factor; PlGF active protein
Ordering
Host
Insect Cells
Reactivity
Rat
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Freeze dried; 25 mM Tris, pH 8.5
Sequence
ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTQTEEPHL
Sequence Length
135
N Terminal Sequence
ALSAGNNSTEMEV
Reconstitution
The rat PlGF is supplied in lyophilized form and can be reconstituted with water. This solution can be diluted into other buffered solutions or stored frozen for future use.
Biological Activity
Measured by its ability to bind recombinant human sFlt-1 in a functional ELISA. Recombinant human sFlt-1 can bind to immobilized recombinant rat PlGF (50ng/well) with a linear range at 0.1 - 5ng/mL
Preparation and Storage
The lyophilized rat PIGF, though stable at room temperature, is best stored in working aliquots at -20 degree C to -70 degree C. Avoid repeated freeze and thaw cycles.

Application Data

product-image-AAA79147_AD13.jpg Application Data

Application Data

product-image-AAA79147_AD15.jpg Application Data
Related Product Information for PlGF active protein
Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse and rat tissues, only one PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Rat PlGF shares about 60% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to rat chromosome 6. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
However, little information regarding the expression pattern and cellular localization of PlGF mRNA in rat placenta during pregnancy is known. RT-PCR analysis shows that the expression level of PlGF mRNA increased as gestation advanced. Using in situ hybridization histochemistry, positive cells of PlGF mRNA were detected in chorionic villi, in the trophoblast and stroma cells surrounding the blood vessels within chorionic villi on day 13 and 15. The expression pattern of PlGF mRNA in rat placenta during pregnancy demonstrates that PlGF plays a functional role for placental growth and fetal development during mid-late pregnancy.
The full ORF of rat PlGF (Met1-Leu158) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols. The native protein expressed in insect cells starts with Ala24.
Product Categories/Family for PlGF active protein
References
1. Osol G et al, Am J Physiol Heart Circ Physiol 294, 2008 2. Choi WS et al, J Vet Sci 6(3), 2005 3. Koh PO et al, J Vet Med Sci 69(9), 2007 4. Torry RJ et al, J Heart Lung Transplant 28(2), 2009 5. Sands M et al, Respir Res 12, 2011

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,14 kDa
NCBI Official Full Name
placenta growth factor
NCBI Official Synonym Full Names
placental growth factor
NCBI Official Symbol
Pgf
NCBI Official Synonym Symbols
Plgf
NCBI Protein Information
placenta growth factor
UniProt Protein Name
Placenta growth factor
UniProt Gene Name
Pgf
UniProt Synonym Gene Names
Plgf; PlGF
UniProt Entry Name
PLGF_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PlGF pgf (Catalog #AAA79147) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Rat PlGF reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: ALSAGNNSTE MEVVPFNEVW GRSYCRPMEK LVYIADEHPN EVSHIFSPSC VLLSRCSGCC GDEGLHCVAL KTANITMQIL KIPPNRDPHS YVEMTFSQDV LCECRPILET TKAERRKTKG KRKQSKTQTE EPHL. It is sometimes possible for the material contained within the vial of "PlGF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.