Application Data
(In vitro: The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean + sem).)
VEGF-C152S active protein
Rat VEGF-C152S
Reactivity
Rat
Purity
> 90% by SDS-PAGE & silver stain
Synonyms
VEGF-C152S; N/A; Rat VEGF-C152S; Vascular Endothelial Growth Factor C; VEGFC; VEGF-C152S active protein
Host
Insect Cells
Reactivity
Rat
Purity/Purification
> 90% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH
Sequence Length
127
Buffer
50 mM acetic acid
Stabilizer
BSA
Reconstitution
Centrifuge the vial prior to opening! The lyophilized VEGF-C152S should be reconstituted in PBS or medium to a concentration not lower than 50 ug/ml.
Biological Activity
(A) The proliferative response to rrVEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells (in vitro). (B) The lymphangiogenic response to rrVEGF-CC152S loaded in a biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats.
Protein RefSeq
NP_446105.1
mRNA RefSeq:
NM_053653.1
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted VEGF-C152S should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles!
Application Data
(In vitro: The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean + sem).)
Application Data
(In vitro: The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean + sem).)
Application Data
(In vivo: The lymphangiogenic response to recombinant rat VEGFCC152S loaded in our biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats. Briefly, after ischemiareperfusion injury to induce myocardial infarction, VEGF-CC152S at the dose of 1.5 or 5 ug per heart was injected intra-myocardially. Lymphatic responses in the myocardium were analyzed by IHC at 3 weeks post-MI using LYVE1 antibody. Results are expressed as lymphatic vessel to cardiomyocyte ratio (mean + sem).The experiments were performed by the research group of Prof. Dr. E. Brakenhielm – Rouen University (see also: Henri O et al., Circulation, March 2016, DOI: 10.1161))
Application Data
(In vivo: The lymphangiogenic response to recombinant rat VEGFCC152S loaded in our biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats. Briefly, after ischemiareperfusion injury to induce myocardial infarction, VEGF-CC152S at the dose of 1.5 or 5 ug per heart was injected intra-myocardially. Lymphatic responses in the myocardium were analyzed by IHC at 3 weeks post-MI using LYVE1 antibody. Results are expressed as lymphatic vessel to cardiomyocyte ratio (mean + sem).The experiments were performed by the research group of Prof. Dr. E. Brakenhielm – Rouen University (see also: Henri O et al., Circulation, March 2016, DOI: 10.1161))
SDS-PAGE
(SDS-PAGE analysis of recombinant rat VEGF-C152 mutant. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.)
SDS-PAGE
(SDS-PAGE analysis of recombinant rat VEGF-C152 mutant. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.)
Related Product Information for VEGF-C152S active protein
VEGF-C152S is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGF-C by a Ser residue. VEGF-C152S is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT-4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR. VEGF-C152S was inactive in the vascular permeability assay and did not increase migration of the capillary endothelial cells, indicating that these VEGF-like effects of VEGF-C require VEGFR-2 binding. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Product Categories/Family for VEGF-C152S active protein
References
1. Joukov et al., J Biol Chem 273 :6599, 1998 2. Joukov et al., EMBO J 15:290, 1996 3. Olofsson et al., Curr Opin Biotech 10:528, 1999 4.Kirkin et al., Eur J Biochem 268:5530, 2001
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18-24 kDa
NCBI Official Full Name
vascular endothelial growth factor C
NCBI Official Synonym Full Names
vascular endothelial growth factor C
NCBI Official Symbol
Vegfc
NCBI Protein Information
vascular endothelial growth factor C; VRP; VEGF-C; flt4-L; flt4 ligand; vascular endothelial growth factor-related protein
UniProt Protein Name
Vascular endothelial growth factor C
UniProt Gene Name
Vegfc
UniProt Synonym Gene Names
VEGF-C; Flt4-L; VRP
UniProt Entry Name
VEGFC_RAT
Similar Products
Product Notes
The VEGF-C152S vegfc (Catalog #AAA79274) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The Rat VEGF-C152S reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: DTVKLAAAHY NTEILKSIDN EWRKTQCMPR EVCIDVGKEF GAATNTFFKP PSVSVYRCGG CCNSEGLQCM NTSTGYLSKT LFEITVPLSQ GPKPVTISFA NHTSCRCMSK LDVYRQVHSI IHHHHHH. It is sometimes possible for the material contained within the vial of "VEGF-C152S, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.