Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) Recombinant Protein | ITIH4 recombinant protein
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial
Gene Names
ITIH4; H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4); N/A; Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial; Inter-alpha-trypsin inhibitor family heavy chain-related protein; IHRP; Plasma kallikrein sensitive glycoprotein 120; Gp120; PK-120; ITIH4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
689-930aa; partial
Sequence
RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Production Note
Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ITIH4 recombinant protein
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Product Categories/Family for ITIH4 recombinant protein
References
cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein.Nishimura H., Kakizaki I., Muta T., Sasaki N., Pu P.X., Yamashita T., Nagasawa S.FEBS Lett. 357:207-211(1995) Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein.Saguchi K., Tobe T., Hashimoto K., Sano Y., Nakano Y., Miura N.-H., Tomita M.J. Biochem. 117:14-18(1995) Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1).Saguchi K., Tobe T., Hashimoto K., Nagasaki Y., Oda E., Nakano Y., Miura N.H., Tomita M.J. Biochem. 119:898-905(1996) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4.Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y.Biochem. Biophys. Res. Commun. 338:1467-1477(2005) The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006) Functional prediction of the coding sequences of 79 new genes deduced by analysis of cDNA clones from human fetal liver.Zhang C., Yu Y., Zhang S., Wei H., Zhang Y., Zhou G., Bi J., Liu M., He F. Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma.Choi-Miura N.-H., Sano Y., Oda E., Nakano Y., Tobe T., Yanagishita T., Taniyama M., Katagiri T., Tomita M.J. Biochem. 117:400-407(1995) Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma.Pu X.P., Iwamoto A., Nishimura H., Nagasawa S.Biochim. Biophys. Acta 1208:338-343(1994) ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells.Pineiro M., Alava M.A., Gonzalez-Ramon N., Osada J., Lasierra P., Larrad L., Pineiro A., Lampreave F.Biochem. Biophys. Res. Commun. 263:224-229(1999) Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.Zhang H., Li X.-J., Martin D.B., Aebersold R.Nat. Biotechnol. 21:660-666(2003) Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R.Proteomics 4:454-465(2004) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Inter-alpha-trypsin inhibitor heavy chain 4 is a novel marker of acute ischemic stroke.Kashyap R.S., Nayak A.R., Deshpande P.S., Kabra D., Purohit H.J., Taori G.M., Daginawala H.F.Clin. Chim. Acta 402:160-163(2009) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) The absolute quantification of eight inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4)-derived peptides in serum from breast cancer patients.van den Broek I., Sparidans R.W., van Winden A.W., Gast M.C., van Dulken E.J., Schellens J.H., Beijnen J.H.Proteomics Clin. Appl. 4:931-939(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.Mol. Cell. Proteomics 0:0-0(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4.Chandler K.B., Brnakova Z., Sanda M., Wang S., Stalnaker S.H., Bridger R., Zhao P., Wells L., Edwards N.J., Goldman R.J. Proteome Res. 13:3314-3329(2014) SNP analysis of the inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene by a fluorescence-adapted SSCP method.Tozaki T., Choi-Miura N.-H., Taniyama M., Kurosawa M., Tomita M.BMC Med. Genet. 3:6-6(2002)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.9 kDa
NCBI Official Full Name
inter-alpha-trypsin inhibitor heavy chain H4 isoform 2
NCBI Official Synonym Full Names
inter-alpha-trypsin inhibitor heavy chain family member 4
NCBI Official Symbol
ITIH4
NCBI Official Synonym Symbols
H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4
NCBI Protein Information
inter-alpha-trypsin inhibitor heavy chain H4
UniProt Protein Name
Inter-alpha-trypsin inhibitor heavy chain H4
UniProt Gene Name
ITIH4
UniProt Synonym Gene Names
IHRP; ITIHL1; PK120; ITI heavy chain H4; ITI-HC4; Inter-alpha-inhibitor heavy chain 4; IHRP; Gp120; PK-120
UniProt Entry Name
ITIH4_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ITIH4 itih4 (Catalog #AAA116661) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 689-930aa; partial. The amino acid sequence is listed below: RLAILPASAP PATSNPDPAV SRVMNMKIEE TTMTTQTPAP IQAPSAILPL PGQSVERLCV DPRHRQGPVN LLSDPEQGVE VTGQYEREKA GFSWIEVTFK NPLVWVHASP EHVVVTRNRR SSAYKWKETL FSVMPGLKMT MDKTGLLLLS DPDKVTIGLL FWDGRGEGLR LLLRDTDRFS SHVGGTLGQF YQEVLWGSPA ASDDGRRTLR VQGNDHSATR ERRLDYQEGP PGVEISCWSV EL. It is sometimes possible for the material contained within the vial of "Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
