Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116172_SDS_PAGE15.jpg SDS-PAGE

Potassium voltage-gated channel subfamily A member 1 protein Recombinant Protein | KCNA1 recombinant protein

Recombinant human Potassium voltage-gated channel subfamily A member 1 protein

Average rating 0.0
No ratings yet
Gene Names
KCNA1; EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily A member 1 protein; N/A; Recombinant human Potassium voltage-gated channel subfamily A member 1 protein; KCNA1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-154aa; Partial
Sequence
MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA116172_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for KCNA1 recombinant protein
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Product Categories/Family for KCNA1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.2 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
NCBI Official Symbol
KCNA1
NCBI Official Synonym Symbols
EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
NCBI Protein Information
potassium voltage-gated channel subfamily A member 1; voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; voltage-gated potassium channel subunit Kv1.1
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 1
UniProt Gene Name
KCNA1
UniProt Entry Name
KCNA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCNA1 kcna1 (Catalog #AAA116172) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-154aa; Partial. The amino acid sequence is listed below: MTVMSGENVD EASAAPGHPQ DGSYPRQADH DDHECCERVV INISGLRFET QLKTLAQFPN TLLGNPKKRM RYFDPLRNEY FFDRNRPSFD AILYYYQSGG RLRRPVNVPL DMFSEEIKFY ELGEEAMEKF REDEGFIKEE ERPLPEKEYQ RQVW. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily A member 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.