Potassium voltage-gated channel subfamily A member 1 protein Recombinant Protein | KCNA1 recombinant protein
Recombinant human Potassium voltage-gated channel subfamily A member 1 protein
Gene Names
KCNA1; EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily A member 1 protein; N/A; Recombinant human Potassium voltage-gated channel subfamily A member 1 protein; KCNA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-154aa; Partial
Sequence
MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for KCNA1 recombinant protein
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Product Categories/Family for KCNA1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.2 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
NCBI Official Symbol
KCNA1
NCBI Official Synonym Symbols
EA1; MK1; AEMK; HBK1; HUK1; MBK1; RBK1; KV1.1
NCBI Protein Information
potassium voltage-gated channel subfamily A member 1; voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; voltage-gated potassium channel subunit Kv1.1
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 1
UniProt Gene Name
KCNA1
UniProt Entry Name
KCNA1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The KCNA1 kcna1 (Catalog #AAA116172) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-154aa; Partial. The amino acid sequence is listed below: MTVMSGENVD EASAAPGHPQ DGSYPRQADH DDHECCERVV INISGLRFET QLKTLAQFPN TLLGNPKKRM RYFDPLRNEY FFDRNRPSFD AILYYYQSGG RLRRPVNVPL DMFSEEIKFY ELGEEAMEKF REDEGFIKEE ERPLPEKEYQ RQVW. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily A member 1 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
