Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Killer cell immunoglobulin-like receptor 2DS1 Recombinant Protein | KI2S1 recombinant protein

Recombinant Homo sapiens Killer cell immunoglobulin-like receptor 2DS1

Average rating 0.0
No ratings yet
Gene Names
KIR2DS1; p50.1; CD158H; CD158a
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Killer cell immunoglobulin-like receptor 2DS1; N/A; Recombinant Homo sapiens Killer cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member HMHC class I NK cell receptor Eb6 ActI; CD158h; KI2S1 recombinant protein
Ordering
Host
Yeast
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length of Extracellular Potential domain, 22-245aa
Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Product Type
Recombinant Protein
Target Name
KI2S1
Tag Info
His-tag
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for KI2S1 recombinant protein
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.76kD
NCBI Official Full Name
killer cell immunoglobulin-like receptor 2DS1
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
NCBI Official Symbol
KIR2DS1
NCBI Official Synonym Symbols
p50.1; CD158H; CD158a
NCBI Protein Information
killer cell immunoglobulin-like receptor 2DS1
UniProt Protein Name
Killer cell immunoglobulin-like receptor 2DS1
UniProt Gene Name
KIR2DS1
UniProt Synonym Gene Names
CD158H

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KI2S1 kir2ds1 (Catalog #AAA309801) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length of Extracellular Potential domain, 22-245aa. The Recombinant Homo sapiens Killer cell immunoglobulin-like receptor 2DS1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: HEGVHRKPSL LAHPGRLVKS EETVILQCWS DVMFEHFLLH REGMFNDTLR LIGEHHDGVS KANFSISRMR QDLAGTYRCY GSVTHSPYQL SAPSDPLDIV IIGLYEKPSL SAQPGPTVLA GENVTLSCSS RSSYDMYHLS REGEAHERRL PAGTKVNGTF QANFPLGPAT HGGTYRCFGS FRDSPYEWSK SSDPLLVSVT GNPSNSWPSP TEPSSETGNP RHLH. It is sometimes possible for the material contained within the vial of "Killer cell immunoglobulin-like receptor 2DS1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.