Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114500_SDS_PAGE15.jpg SDS-PAGE

Kallikrein 1-related peptidase b22 Recombinant Protein | Klk1b22 recombinant protein

Recombinant Mouse Kallikrein 1-related peptidase b22

Average rating 0.0
No ratings yet
Gene Names
Klk1b22; Klk22; Egfbp1; mGk-22; Egfbp-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kallikrein 1-related peptidase b22; N/A; Recombinant Mouse Kallikrein 1-related peptidase b22; Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP A; Glandular kallikrein K22; mGK-22; Nerve growth factor beta chain endopeptidase; Tissue kallikrein 22; Klk1b22 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-259aa; Full Length
Sequence
ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Sequence Length
259
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114500_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Klk1b22 recombinant protein
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
References
Mouse glandular kallikrein genes identification and characterization of the genes encoding the epidermal growth factor binding proteins.Drinkwater C.C., Evans B.A., Richards R.I.Biochemistry 26:6750-6756(1987) Beta-NGF-endopeptidase structure and activity of a kallikrein encoded by the gene mGK-22.Fahnestock M., Woo J.E., Lopez G.A., Snow J., Walz D.A., Arici M.J., Mobley W.C.Biochemistry 30:3443-3450(1991) mGK-6-derived true tissue kallikrein is synthesized, processed, and targeted through a regulated secretory pathway in mouse pituitary AtT-20 cells.Peters J., Takahashi S., Tada M., Miyake Y.J. Biochem. 111:643-648(1992) Mouse glandular kallikrein genes. Structure and partial sequence analysis of the kallikrein gene locus.Evans B.A., Drinkwater C.C., Richards R.I.J. Biol. Chem. 262:8027-8034(1987)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.8 kDa
NCBI Official Full Name
kallikrein 1-related peptidase b22
NCBI Official Synonym Full Names
kallikrein 1-related peptidase b22
NCBI Official Symbol
Klk1b22
NCBI Official Synonym Symbols
Klk22; Egfbp1; mGk-22; Egfbp-1
NCBI Protein Information
kallikrein 1-related peptidase b22
UniProt Protein Name
Kallikrein 1-related peptidase b22
UniProt Gene Name
Klk1b22
UniProt Synonym Gene Names
Klk-22; Klk22; EGF-BP A; mGK-22
UniProt Entry Name
K1B22_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Klk1b22 klk1b22 (Catalog #AAA114500) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-259aa; Full Length. The amino acid sequence is listed below: ILGGFKCEKN SQPWQVAVYY LDEYLCGGVL LDRNWVLTAA HCYEDKYNIW LGKNKLFQDE PSAQHRLVSK SFPHPDFNMS LLQSVPTGAD LSNDLMLLRL SKPADITDVV KPIDLPTTEP KLGSTCLASG WGSINQLIYQ NPNDLQCVSI KLHPNEVCVK AHILKVTDVM LCAGEMNGGK DTCKGDSGGP LICDGVLQGI TSWGSTPCGE PNAPAIYTKL IKFTSWIKDT MAKNP. It is sometimes possible for the material contained within the vial of "Kallikrein 1-related peptidase b22, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.