Glandular kallikrein-7 Recombinant Protein | Klk7 recombinant protein
Recombinant Rat Glandular kallikrein-7, submandibular/renal
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glandular kallikrein-7; N/A; Recombinant Rat Glandular kallikrein-7, submandibular/renal; Esterase B; Kallikrein-related protein K1; Proteinase ARSKG-7; Tissue kallikrein; Klk7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-261aa; Full Length
Sequence
VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP
Sequence Length
261
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Klk7 recombinant protein
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
References
Molecular cloning and characterization of two rat renal kallikrein genes.Chen Y.-P., Chao J., Chao L.Biochemistry 27:7189-7196(1988) Characterization of serine proteinases isolated from rat submaxillary gland with special reference to the degradation of rat kininogens by these enzymes.Kato H., Nakanishi E., Enjyoji K., Hayashi I., Oh-Ishi S., Iwanaga S.J. Biochem. 102:1389-1404(1987) Substrate specificity of two kallikrein family gene products isolated from the rat submaxillary gland.Elmoujahed A., Gutman N., Brillard M., Gauthier F.FEBS Lett. 265:137-140(1990) The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.3 kDa
NCBI Official Full Name
kallikrein 1
UniProt Protein Name
Glandular kallikrein-7, submandibular/renal
UniProt Gene Name
Klk7
UniProt Synonym Gene Names
Klk-7; rGK-7
UniProt Entry Name
KLK7_RAT
Similar Products
Product Notes
The Klk7 klk7 (Catalog #AAA113163) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-261aa; Full Length. The amino acid sequence is listed below: VIGGYKCEKN SQPWQVALYS FTKYLCGGVL IDPSWVITAA HCSSNNYQVW LGRNNLLEDE PFAQHRLVSQ SFPHPDYKPF LMRNHTRKPG DDHSNDLMLL HLSQPADITD GVKVIDLPTE EPKVGSTCLA SGWGSTKPLI WEFPDDLQCV NIHLLSNEKC IKAYKEKVTD LMLCAGELEG GKDTCTGDSG GPLLCDGVLQ GITSWGSVPC AKTNMPAIYT KLIKFTSWIK EVMKENP. It is sometimes possible for the material contained within the vial of "Glandular kallikrein-7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
