Killer cell lectin-like receptor subfamily G member 1 (Klrg1) Recombinant Protein | Klrg1 recombinant protein
Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1)
Gene Names
Klrg1; MAFA; 2F1-Ag; MAFA-L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Killer cell lectin-like receptor subfamily G member 1 (Klrg1); N/A; Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1); Killer cell lectin-like receptor subfamily G member 1; Mast cell function-associated antigen 2F1; Klrg1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
57-188aa; Partial
Sequence
QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,396 Da
NCBI Official Full Name
killer cell lectin-like receptor subfamily G member 1
NCBI Official Synonym Full Names
killer cell lectin-like receptor subfamily G, member 1
NCBI Official Symbol
Klrg1
NCBI Official Synonym Symbols
MAFA; 2F1-Ag; MAFA-L
NCBI Protein Information
killer cell lectin-like receptor subfamily G member 1; mast cell function-associated antigen 2F1
UniProt Protein Name
Killer cell lectin-like receptor subfamily G member 1
UniProt Gene Name
Klrg1
UniProt Synonym Gene Names
Mafa
UniProt Entry Name
KLRG1_MOUSE
Similar Products
Product Notes
The Klrg1 klrg1 (Catalog #AAA115228) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 57-188aa; Partial. The amino acid sequence is listed below: QRILCCGSKD STCSHCPSCP ILWTRNGSHC YYFSMEKKDW NSSLKFCADK GSHLLTFPDN QGVKLFGEYL GQDFYWIGLR NIDGWRWEGG PALSLRILTN SLIQRCGAIH RNGLQASSCE VALQWICKKV LY. It is sometimes possible for the material contained within the vial of "Killer cell lectin-like receptor subfamily G member 1 (Klrg1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.