Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Keratin Recombinant Protein | K1C14 recombinant protein

Recombinant Human Keratin, type I cytoskeletal 14

Average rating 0.0
No ratings yet
Gene Names
KRT14; K14; NFJ; CK14; EBS3; EBS4
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Keratin; N/A; Recombinant Human Keratin, type I cytoskeletal 14; Cytokeratin-14; CK-14; Keratin-14; K14; K1C14 recombinant protein
Ordering
Host
Yeast
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
Full Length, 1-472aa
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYGG GFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANA DLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEA DINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRD QYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEET KGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGS QSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Calculated MW
53.6 kDa
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for K1C14 recombinant protein
The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.6 kDa
NCBI Official Full Name
keratin, type I cytoskeletal 14
NCBI Official Synonym Full Names
keratin 14
NCBI Official Symbol
KRT14
NCBI Official Synonym Symbols
K14; NFJ; CK14; EBS3; EBS4
NCBI Protein Information
keratin, type I cytoskeletal 14
UniProt Protein Name
Keratin, type I cytoskeletal 14
UniProt Gene Name
KRT14
UniProt Synonym Gene Names
CK-14; K14

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The K1C14 krt14 (Catalog #AAA309778) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-472aa. The Recombinant Human Keratin, type I cytoskeletal 14 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MTTCSRQFTS SSSMKGSCGI GGGIGGGSSR ISSVLAGGSC RAPSTYGGGL SVSSSRFSSG GACGLGGGYG G GFSSSSSS FGSGFGGGYG GGLGAGLGGG FGGGFAGGDG LLVGSEKVTM QNLNDRLASY LDKVRALEEA NA DLEVKIR DWYQRQRPAE IKDYSPYFKT IEDLRNKILT ATVDNANVLL QIDNARLAAD DFRTKYETEL NLRMSVEA D INGLRRVLDE LTLARADLEM QIESLKEELA YLKKNHEEEM NALRGQVGGD VNVEMDAAPG VDLSRILNEM RD QYEKMAE KNRKDAEEWF FTKTEELNRE VATNSELVQS GKSEISELRR TMQNLEIELQ SQLSMKASLE NSLEET KGR YCMQLAQIQE MIGSVEEQLA QLRCEMEQQN QEYKILLDVK TRLEQEIATY RRLLEGEDAH LSSSQFSSGS QSSRDVTSS SRQIRTKVMD VHDGKVVSTH EQVLRTKN. It is sometimes possible for the material contained within the vial of "Keratin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.