SDS-PAGE
L-lactate dehydrogenase Recombinant Protein | LDH recombinant protein
Recombinant Plasmodium berghei L-lactate dehydrogenase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-lactate dehydrogenase; Recombinant Plasmodium berghei L-lactate dehydrogenase; LDH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-316aa; Full Length
Sequence
MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI
Sequence Length
316
Species
Plasmodium berghei
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for LDH recombinant protein
References
Expression of Plasmodium falciparum lactate dehydrogenase in Escherichia coli.Bzik D.J., Fox B.A., Gonyer K.Mol. Biochem. Parasitol. 59:155-166(1993)
The structure of lactate dehydrogenase from Plasmodium falciparum reveals a new target for anti-malarial design.Dunn C., Banfield M., Barker J., Higham C., Moreton K., Turgut-Balik D., Brady L., Holbrook J.J.Nat. Struct. Biol. 3:912-915(1996)
Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.Read J.A., Wilkinson K.W., Tranter R., Sessions R.B., Brady R.L.J. Biol. Chem. 274:10213-10218(1999)
The structure of lactate dehydrogenase from Plasmodium falciparum reveals a new target for anti-malarial design.Dunn C., Banfield M., Barker J., Higham C., Moreton K., Turgut-Balik D., Brady L., Holbrook J.J.Nat. Struct. Biol. 3:912-915(1996)
Chloroquine binds in the cofactor binding site of Plasmodium falciparum lactate dehydrogenase.Read J.A., Wilkinson K.W., Tranter R., Sessions R.B., Brady R.L.J. Biol. Chem. 274:10213-10218(1999)
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
39.4 kDa
UniProt Protein Name
L-lactate dehydrogenase
UniProt Entry Name
LDH_PLAFD
Similar Products
Product Notes
The LDH (Catalog #AAA18723) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-316aa; Full Length. The amino acid sequence is listed below: MAPKAKIVLV GSGMIGGVMA TLIVQKNLGD VVMFDIVKNM PHGKALDTSH TNVMAYSNCK VSGSNTYDDL KDADVVIVTA GFTKAPGKSD KEWNRDDLLP LNNKIMIEIG GHIKNNCPNA FIIVVTNPVD VMVQLLHQHS GVPKNKIVGL GGVLDTSRLK YYISQKLNVC PRDVNAHIVG AHGNKMVLLK RYITVGGIPL QEFINNKKIT DQELDAIFDR TINTALEIVN LHASPYVAPA AAIIEMAESY IRDLRKVLIC STLLEGQYGH KDIFAGTPLV IGGNGVEQVI ELQLNADEKK KFDEAVAETS RMKALI. It is sometimes possible for the material contained within the vial of "L-lactate dehydrogenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
