Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18603_SDS_PAGE.jpg SDS-PAGE

papillomavirus type 16 Minor capsid protein L2 (L2) Recombinant Protein | L2 recombinant protein

Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
papillomavirus type 16 Minor capsid protein L2 (L2); N/A; Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2); L2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-473aa; Full Length
Sequence
MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIAEQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18603_SDS_PAGE.jpg SDS-PAGE
Related Product Information for L2 recombinant protein
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, escorts the genomic DNA into the nucleus, in particular by promoting virion endosomal escape. It is involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.
References
Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985) Cloning and sequencing of non-European human papillomavirus (HPV) variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Interaction of human papillomavirus type 16 L2 with cellular proteins identification of novel nuclear body-associated proteins.Goernemann J., Hofmann T.G., Will H., Mueller M.Virology 303:69-78(2002)Interaction of human papillomavirus (HPV)type 16 capsid proteins with HPV DNA requires an intact L2 N-terminal sequence.Zhou J., Sun X.Y., Louis K., Frazer I.H.J. Virol. 68:619-625(1994) Human papillomavirus type 16 capsid proteins produced from recombinant Semliki Forest virus assemble into virus-like particles.Heino P., Dillner J., Schwartz S.Virology 214:349-359(1995) Nuclear translocation of papillomavirus minor capsid protein L2 requires Hsc70.Florin L., Becker K.A., Sapp C., Lambert C., Sirma H., Muller M., Streeck R.E., Sapp M.J. Virol. 78:5546-5553(2004) The l2 minor capsid protein of human papillomavirus type 16 interacts with a network of nuclear import receptors.Darshan M.S., Lucchi J., Harding E., Moroianu J.J. Virol. 78:12179-12188(2004) Human papillomavirus 16 L2 inhibits the transcriptional activation function, but not the DNA replication function, of HPV-16 E2.Okoye A., Cordano P., Taylor E.R., Morgan I.M., Everett R., Campo M.S.Virus Res. 108:1-14(2005) Expression pattern and subcellular localization of human papillomavirus minor capsid protein L2.Lin Z., Yemelyanova A.V., Gambhira R., Jagu S., Meyers C., Kirnbauer R., Ronnett B.M., Gravitt P.E., Roden R.B.Am. J. Pathol. 174:136-143(2009) Two highly conserved cysteine residues in HPV16 L2 form an intramolecular disulfide bond and are critical for infectivity in human keratinocytes.Campos S.K., Ozbun M.A.PLoS ONE 4:E4463-E4463(2009) Identification of the dynein light chains required for human papillomavirus infection.Schneider M.A., Spoden G.A., Florin L., Lambert C.Cell. Microbiol. 13:32-46(2011)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66.7 kDa
NCBI Official Full Name
minor capsid protein
NCBI Official Symbol
L2
NCBI Protein Information
minor capsid protein
UniProt Protein Name
Minor capsid protein L2
UniProt Gene Name
L2
UniProt Entry Name
VL2_HPV16

Similar Products

Product Notes

The L2 l2 (Catalog #AAA18603) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-473aa; Full Length. The amino acid sequence is listed below: MRHKRSAKRT KRASATQLYK TCKQAGTCPP DIIPKVEGKT IAEQILQYGS MGVFFGGLGI GTGSGTGGRT GYIPLGTRPP TATDTLAPVR PPLTVDPVGP SDPSIVSLVE ETSFIDAGAP TSVPSIPPDV SGFSITTSTD TTPAILDINN TVTTVTTHNN PTFTDPSVLQ PPTPAETGGH FTLSSSTIST HNYEEIPMDT FIVSTNPNTV TSSTPIPGSR PVARLGLYSR TTQQVKVVDP AFVTTPTKLI TYDNPAYEGI DVDNTLYFSS NDNSINIAPD PDFLDIVALH RPALTSRRTG IRYSRIGNKQ TLRTRSGKSI GAKVHYYYDL STIDPAEEIE LQTITPSTYT TTSHAASPTS INNGLYDIYA DDFITDTSTT PVPSVPSTSL SGYIPANTTI PFGGAYNIPL VSGPDIPINI TDQAPSLIPI VPGSPQYTII ADAGDFYLHP SYYMLRKRRK RLPYFFSDVS LAA . It is sometimes possible for the material contained within the vial of "papillomavirus type 16 Minor capsid protein L2 (L2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.