Leukocyte cell-derived chemotaxin 1 Recombinant Protein | LECT1 recombinant protein
Recombinant Human Leukocyte cell-derived chemotaxin 1
Gene Names
LECT1; CHM1; CHM-I; BRICD3; MYETS1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukocyte cell-derived chemotaxin 1; N/A; Recombinant Human Leukocyte cell-derived chemotaxin 1; Cleaved into the following 2 chains: 1. Chondrosurfactant protein; 2. CH-SP 3. Chondromodulin-1; Chondromodulin-I; ChM-I; LECT1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
215-334aa; Partial
Sequence
EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
Sequence Length
334
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for LECT1 recombinant protein
Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.
Product Categories/Family for LECT1 recombinant protein
References
"Expression of cartilage-specific functional matrix chondromodulin-I mRNA in rabbit growth plate chondrocytes and its responsiveness to growth stimuli in vitro." Shukunami C., Hiraki Y. Biochem. Biophys. Res. Commun. 249:885-890(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29.8 kDa
NCBI Official Full Name
leukocyte cell-derived chemotaxin 1 isoform 2
NCBI Official Synonym Full Names
leukocyte cell derived chemotaxin 1
NCBI Official Symbol
LECT1
NCBI Official Synonym Symbols
CHM1; CHM-I; BRICD3; MYETS1
NCBI Protein Information
leukocyte cell-derived chemotaxin 1
UniProt Protein Name
Leukocyte cell-derived chemotaxin 1
UniProt Gene Name
LECT1
UniProt Synonym Gene Names
CHMI; CH-SP; ChM-I
UniProt Entry Name
LECT1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The LECT1 lect1 (Catalog #AAA114620) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 215-334aa; Partial. The amino acid sequence is listed below: EVVRKIVPTT TKRPHSGPRS NPGAGRLNNE TRPSVQEDSQ AFNPDNPYHQ QEGESMTFDP RLDHEGICCI ECRRSYTHCQ KICEPLGGYY PWPYNYQGCR SACRVIMPCS WWVARILGMV. It is sometimes possible for the material contained within the vial of "Leukocyte cell-derived chemotaxin 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
